KEGG   Ictalurus punctatus (channel catfish): 108280131
Entry
108280131         CDS       T04658                                 

Definition
(RefSeq) uncharacterized LOC108280131
  KO
K05461  KIT ligand
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108280131
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108280131
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ipu04052]
    108280131
Cytokines and growth factors [BR:ipu04052]
 Growth factors
  Growth factors (RTK binding)
   108280131
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 108280131
NCBI-ProteinID: XP_017350384
UniProt: A0A2D0T668
LinkDB
Position
19
AA seq 257 aa
MVHMKEIKIGGCACVLVLLFSGLVACSGVFGSPLTDDVATLDTLRENIPKDYKIRVRYIS
KDVGGMCWVHLNLYPAESSLKNLALKFGNVSSNRENITIFITMLQGLRVTIDNEELESTM
QAFKCHYRSARWSTRRYFDHIKEVLVTFASTPHQFYCTPPPCPTPTAPVVTSDRRVIDRA
VPGVLALLVIPCLAALALILRTVLRRKMCCVERRHEESDDVARQSDPDASIDASHNDSQS
CFLNNQYRVQQVEDTGV
NT seq 774 nt   +upstreamnt  +downstreamnt
atggtccacatgaaggagattaagatcggaggatgcgcatgtgtgttggtgttgctcttt
tccgggcttgtcgcctgctctggtgtgtttggaagtcctttgactgacgatgtggccaca
ctagacacactgagagaaaacattcccaaggattacaaaattcgtgttcgttacatttcc
aaagacgtgggagggatgtgctgggttcacctgaacctgtatccagcagagagcagtttg
aaaaacttagccctgaagtttggcaacgtttcatccaacagagaaaatattactatcttc
atcaccatgctgcaaggacttcgcgtcaccattgataacgaggagttggagtcaacaatg
caggcctttaagtgtcattatcggagtgcacgatggtccaccagacgctatttcgaccac
atcaaagaggttcttgtaacatttgcctccacaccccaccagttttactgtactcctcct
ccatgtcccactcctactgcacctgtagttacatcagatcggcgtgtgattgaccgagcg
gtcccaggtgttctagcgttactcgtcattccctgtcttgctgcacttgcgctcattctc
agaacagtgcttcgtcgaaaaatgtgctgtgtggaaaggagacatgaagagagcgatgac
gtggcgagacaaagtgaccctgacgccagtatagatgcgtcacacaatgacagtcaatca
tgtttcttaaataaccaatacagggtgcagcaggttgaggacactggcgtttaa

DBGET integrated database retrieval system