KEGG   Ictalurus punctatus (channel catfish): 108280634Help
Entry
108280634         CDS       T04658                                 

Definition
(RefSeq) uncharacterized LOC108280634
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108280634
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ipu03036]
    108280634
Enzymes [BR:ipu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108280634
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108280634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 108280634
NCBI-ProteinID: XP_017351325
UniProt: A0A2D0T9J8
LinkDB All DBs
Position
2
AA seq 2136 aa AA seqDB search
MEGSYRMSVRELCETDDLATSLVLDPLLGFSTHKMNISPLPEIRRWSYLRETLLRFKRTR
DFQSTFDSLLEGEWTSEYFRDLGSHRQELLRQHMYRYLTAFLLDSGVQIESCDRYSSETN
GAKITATRNWSVGERVEVLQGCIAELNPTDSAVLRTGVNDFSVMYSTRKQCAQLWLGPAA
FINHDCRPNCKFVPGDKNGACVKVVRPISPGEEITCYYGDSFFGEDNEMCECCTCERRGK
GFFRHRLAALQEWEGLNDPLGQKYRFRETDLRLNREKGNSTPSPFLTVSNPACSVKNSQQ
TKRNAPTASSRTTKTKRWKREERVKQAEKTQHNHFFISSLSRFNLKDSSVCLYSHSVDFL
LSCKDPASKERALLHRIESVRPKLESRDSPDVLGPPSPADVELIRGEEGRDVRSNDVSSN
TDELNLKPFTLTSVSSGDKDPANEEAETAAVRVVHQMAISSRTRNMLRTRLRCSGAFDRG
KLSRLNKKAVKMIRRTSKLHAGRCRRGAVGKGGPRKPCSNRKRRETNSKSSAAITEEMQR
SFGDSHKATADGEKRITVSGAAREGDSSSPITSEISRELQKKHIPSVVSGTIDVTTSSMD
LSSTHPPPPSPPPSLPPPPPSASSSFSSLPSGLTRYVKVSLVRVSMPGERAAVQADQGIA
GSGENADPTPPSAVEKQISKCKRSKGISRVSVKKGVREMYFTPSADSFLKVTCDIESSGN
SIAQPVAQVSHKGSERNNDGQEIDGNSGSSKRDGMTSGSVRDEKSLVEDNEVVTNLRKRR
QVPKGQRKPSEMGTAEEKDEEKRKGKQGEVTKQTEDTVQKESDLLRYGSKTVVIKESRVL
LSDILKSLSSDLVSQGPDGKAYHSAVGNSLRSGESASIKRLISLTDPPRLNFESLKKNPG
VARVTHLAQRSAQVSEDHQGAKVAKKKVPEIIPLFSESLSPLKGSLDHNSQSSIPLKKRV
FRESVETDPDQDASVTTTTTESPCPSKSIETRSEKGLLPVSQDDGTVDNGAQNLTLQLSS
SFKDEGVGSKKGRLCKSLMSKKLQQRKCFRTAQARPAQAPHRMFRERGSTGSQSTAKTPE
IRVYMNRKCKMKSELGSGVEDISVGKEINEDAREAGQNLAEEAQENTKAEVDVLSASESS
VNTEDEQNLNFRIRLKRKRGKEWEMESEFKGESAVGETQSSEPRADSIDPFKAILDSVAI
LNLEMERIRGHGEADKSVGLEQATKAVQDVLEHCQKESTFKSRKRHKKMLSGANINNERR
SNGQEASVQGKMEIPEVLEQQRQFVRRLKVEADNMDVKPLPLLRLRRRAEGRWEVEDEEA
QTQDGNVGAGNFVLKDSRNLSCFFPERMPRGEMALSRVKEENLSPCQHRTAASKCERMRE
LSKGMASSEPSLLSLSPLSLNSPYHEGLTEISHLARGKETLAPERVENLESAELGEVCLS
HNLFQINKSLSKLQAMSQQQPSCAPVNISATTSCQIQSKPLSPPTSPFTTECNFSNYSED
ILDFHCLNLDGYDQTHTQNSLQNTLTDYCAGEPHNTGSFSSPFSQSPADGWNPETPYLGS
PSPGSSFSTPEDLSFPDLGLTRYDTPSLNSEFSSKDKAFCPAATGSAAVKDSDRNAFFSD
SASTKRNVIFQSKEDCVTPLICVADKTLSSQRDLIIFNTSSNAKQTVSPAACLLSQDKMH
FLDRSLSAQSDFGRVQTKDKNNEPLNFVSSANKSHATVLSQSVSGLYNAGLQSNPVKPFH
SLHTGSKTTSCSEFPGPLNLGNTVFRGYEKKPTVFQNYNSLVKIEGGGGYGPNVCKGSSA
GDSKLSLKSHGSKSDLSDSVPGPSSLRNLKDLSSECSQSAYSRYAEASRREPKTVPPNKG
LSKAHPQGDRVYPVYFLSSSKTATNAVRNTPVEKPQNVRADHPDVPSPFFHSTQSHSILN
SKNLRQDKPHAVVAPSQSSQVSVPLDRNQLCFSHCDPLEVSFASSLSPGVSRHGSPQVSY
RDSVSQEAPASKPQPSSFTCSQSAHPSYVVNFTGDHSVTLNYNDGGECLNYLSSVPTNYT
YHCLMEPSGTQGRLIVEPCGPSTITHSPMGGFAGPKGPAETSKDSQQHGQSGCHPHISHH
FPSSHSQSASLTDRKPKRLRLVVTDGTVDLDLQYTD
NT seq 6411 nt NT seq  +upstreamnt  +downstreamnt
atggaaggatcgtatagaatgagtgtgagggagctgtgtgagacggatgacttggctacg
agtctggtgctggacccgttactcgggttcagcacccataagatgaacataagtcctctg
ccagagatccggcggtggagctacctgagggagacgctgctacgcttcaagcgcactcgg
gacttccagtccacgttcgactccctgctggagggcgagtggacgagcgagtacttccga
gacctcggctcgcaccggcaggagctgctgaggcaacacatgtaccgctatctcactgcc
ttcctattggacagcggagtccagatcgagtcatgtgaccgctattcttcggagaccaat
ggcgctaaaatcacagcaacaagaaactggtcggtcggagagcgtgtggaagtgctgcag
ggctgtatagctgagctgaatcccactgacagcgccgtgctcaggaccggcgtgaacgat
ttcagcgtgatgtactcgacgcgtaagcagtgcgctcagctctggctcggcccggctgcc
ttcatcaaccacgactgcaggccgaattgtaagtttgtacctggggataagaacggagcg
tgcgtgaaggttgtccgtcccatctcacctggggaggagatcacatgttactatggcgac
agcttttttggagaagacaatgagatgtgtgaatgttgcacctgcgagaggagaggaaaa
gggttcttccggcacagactggccgcgctgcaagagtgggaaggcttgaacgatccacta
ggccagaaatacaggttcagagagacggacctgcggctcaaccgagagaaagggaacagt
actccaagtccgttcctcacggtatctaacccagcctgctctgtgaagaattcccagcag
acgaagagaaacgcccctacagcaagcagcaggacgacaaagaccaagaggtggaaaagg
gaggagcgagtcaaacaggctgagaagacacaacacaaccacttcttcatatcgtccttg
tctcgtttcaacctgaaggattcgagcgtgtgcttgtatagtcacagcgtggacttcctg
ctaagctgcaaggatcccgccagcaaggaaagagcgctcttgcacagaatcgagagcgtg
agaccaaaattggagagtcgtgactctccggatgtgctcggccctccgtctcccgctgac
gtcgaactaatcagaggcgaggaagggcgggacgtccgaagtaacgacgtatcgagtaac
accgatgagctaaacttaaagcctttcacgttaacctcggtttcgagtggcgataaagac
cctgcgaacgaagaggcggaaaccgccgccgtccgggtcgttcaccagatggccatttct
tcacgaaccaggaatatgcttcgcacccgactccgatgctctggagccttcgatcgaggt
aaactctctcgcttgaataaaaaggcggtcaaaatgatacgccggacatctaagctgcac
gcgggtcggtgtagaagaggcgctgtcggaaaaggtggcccacggaagccttgctcaaac
agaaaaagacgagaaacaaacagcaagtcatcggcggcgatcacagaggagatgcagcgc
agctttggggattctcacaaggccacggctgacggcgagaagcgcatcaccgtctctggc
gctgctagggaaggggattcaagctccccaattacttcggagatctccagggagctgcag
aaaaaacacatcccttctgtcgtttctggcaccatcgatgttactacttcatcgatggat
ctttcctccactcacccaccaccaccaagtcctcctccttctcttcctcctcctcctcct
tcagcttcttcttctttttcttctctcccttcagggttgacgcgttatgtaaaagtcagt
ctggtcagagtgtcgatgccaggggagagagcagctgttcaggcagatcagggaatagca
ggcagtggagaaaacgcagatcctacgcctccgtcagctgtagagaagcagatctcgaag
tgcaaacggagcaaaggtatctcaagagtcagtgttaagaaaggggttagggagatgtac
tttactccgagcgcagacagctttttaaaggtgacgtgtgacatagaaagtagtgggaat
tccatagcacaacctgttgcacaggtgtcacataagggtagcgagagaaataacgacggt
caggaaatagatggaaatagcggtagcagtaagagggacggtatgacttctggttctgta
cgtgatgagaaatctttggtagaggacaacgaagtagtgactaatttaaggaaaagaaga
caagtgccaaaaggtcaaagaaaaccgagtgaaatgggtacagcggaagaaaaggatgag
gaaaagcgtaaaggtaagcaaggtgaggtaactaagcaaacagaagatactgtacaaaag
gaatcggatttgttgcgttatggaagtaaaactgttgtcataaaagagtcgagagtcctc
ctgtcagatattttaaaaagcttgagcagtgatttggttagccaaggaccggacggtaaa
gcgtaccacagtgcagtcgggaattctttgcgatcaggtgagtcagcgtcgattaaaaga
ttgatatcccttactgatcccccgagattgaattttgaatctctgaaaaagaaccctggg
gttgctagggtaacccacttggcccagcgtagtgcgcaggtttcagaagaccatcaaggc
gcaaaagtggccaaaaaaaaagttccagaaattattccactcttctccgagtctctctcc
cctctaaaaggcagcctggatcacaattcccagagcagcatcccgctaaagaaacgggtt
tttcgcgagtccgtcgaaaccgatccggatcaagatgcaagcgtaaccacgactacgacg
gagtctccgtgccccagtaaaagtatcgagaccaggtcggaaaaaggtctgttacctgtg
tctcaagacgacgggaccgtcgataacggagctcagaacctaacattacagttgagctct
tctttcaaagacgaaggggtaggatcaaaaaagggcaggctttgtaaatccttaatgtcc
aagaagctacaacaaagaaaatgctttcgaactgctcaggctagaccggcacaagctcct
catagaatgttcagagaaagaggtagtacaggtagccagtcgacagctaagacacctgaa
attagagtatatatgaatagaaaatgcaaaatgaaatctgagcttggatccggagtggag
gatatcagtgtaggaaaagaaataaacgaggacgcaagagaggccgggcaaaatttagca
gaggaggcgcaggaaaacacaaaagctgaagtggacgtcttgtccgcgtcggaatcttcg
gtcaacaccgaagacgagcagaaccttaattttagaatacgtctgaaaaggaagaggggg
aaggaatgggaaatggagagtgaattcaagggggaaagtgctgtgggtgaaacacagagc
tcagaaccacgcgctgattccattgacccctttaaggccattttggattctgtggcaatc
ttaaacttggaaatggagcgcattcggggtcacggagaagcagacaagagtgtgggtctg
gagcaagccaccaaggccgttcaagacgtcttggaacattgccaaaaagaaagtactttc
aaatccaggaaaaggcataaaaaaatgttatccggtgctaacatcaacaacgaaagacgt
tctaatggacaagaagcctctgttcaaggtaaaatggagattcctgaggtgctagaacaa
cagcggcagtttgttcggcgtctcaaagtcgaagcggataacatggacgtcaaaccgtta
cctctgcttcggttgcgccgccgggccgagggcagatgggaggtggaggacgaggaagct
caaacacaagacggaaacgttggagcgggaaattttgtgctgaaggactcccgaaatctg
tcgtgcttctttcctgagaggatgccgaggggagagatggctctgagcagagtcaaagag
gagaacttgtctccttgccagcaccggacagcagctagcaagtgcgaaaggatgagagag
ctctctaaaggcatggcctcttcagagccttccctactgtccctttcacccttatctctg
aactctccatatcatgaagggctaacggaaatatcccacctcgcaagaggtaaagaaacg
cttgcgccggaaagagtcgagaacctcgagagcgcagagttgggcgaggtttgcttaagt
cacaacttgtttcaaatcaacaaaagcctctctaaacttcaagccatgagccaacagcag
ccatcatgtgcacctgttaacatcagcgcaactacctcctgtcagattcagtccaaacct
ttgtctcctccaacctccccttttaccaccgaatgcaacttttcaaactattccgaggac
attttagattttcactgcttgaatctcgacggctacgatcaaacgcacacacaaaacagc
ctccaaaacacactgactgactactgtgccggagaaccgcacaacactgggtcttttagt
agccccttctctcaaagcccagccgacgggtggaaccccgagaccccttacctcggctcc
ccgagcccggggagtagctttagtactccggaagacttgagttttcccgatcttgggctt
acacgatacgacacgccgtctctaaacagtgagttctcttccaaagataaagcgttttgt
ccagcagcgacgggttcagccgccgtcaaggattcggacagaaacgcgttcttttccgac
agcgcgtcgacaaagcgcaacgtgatttttcaatccaaggaagattgtgtaacaccgctg
atttgtgtggcagataaaacattaagcagccagagagacttaataatatttaacacatcc
tcaaacgctaagcagactgtctcgcctgcggcttgcttgctgtctcaggataagatgcat
ttccttgacaggagtctgtcggcccagtcggactttggtagagttcaaaccaaggacaaa
aataacgagccgctcaacttcgttagctcagctaataaatcccatgctaccgtcctgagt
cagtctgtgtcaggtttatacaatgctggcttacaaagcaaccctgttaaacccttccac
tcacttcatacaggaagtaaaaccacgtcatgctcagagttcccaggacctctgaacctt
ggcaatacggttttccgtggctatgagaagaagcctacggttttccagaactacaacagt
ttggtgaaaatcgaaggaggaggaggatacggtccgaacgtttgcaaaggttcttcagca
ggcgactctaaactttctttgaaatctcatggcagcaagtccgatctttccgactcggtt
ccggggccgtcgagtttacgcaatctcaaggatttatcctcagagtgttctcaaagtgcg
tattcgcgatacgccgaagcctcaagaagagagccgaagaccgttccaccaaacaaagga
ctatctaaagcacacccacagggcgatcgggtttacccagtttactttctcagctcgagc
aaaaccgcgacgaatgccgtcaggaacacgcctgtcgaaaagcctcaaaacgtaagggct
gaccatcctgacgtcccttctccgttttttcacagcactcagagtcacagcatacttaac
agtaaaaacctaagacaagataaaccccacgctgtggtagcaccaagtcagagctctcaa
gtctcggtcccgctcgacagaaatcagctctgtttctcgcactgtgatcccttagaagtc
agctttgcctcttcactgtcccccggcgtttcccgacacggcagtccacaagtgagctac
agagattccgtcagtcaggaagctccagcgtccaaacctcagccgtcctccttcacgtgc
agtcagtccgcccacccgtcttacgtcgtgaacttcaccggtgatcactcggttaccttg
aactacaacgacggcggcgaatgtttgaattacttgtcatccgtgcccacgaattacact
taccattgcctcatggagccttccggaacccagggaaggcttatcgtagaaccgtgtggt
ccatcgaccatcacgcattctcctatgggtggcttcgcgggccctaaaggcccggcggag
acgagcaaggactctcagcagcacgggcagtccggatgccatccgcacatttcccatcac
ttcccgtcgtcacactctcaaagcgcctctctgacggaccgcaagcccaagagactgcgg
ctggtcgttactgacggtacagtagacctggacctgcagtacacggactga

DBGET integrated database retrieval system