KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW000555Help
Entry
IscW_ISCW000555   CDS       T01131                                 

Definition
(RefSeq) succinate dehydrogenase, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00020  Citrate cycle (TCA cycle)
isc00190  Oxidative phosphorylation
isc01100  Metabolic pathways
isc01200  Carbon metabolism
Module
isc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
isc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
isc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IscW_ISCW000555
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IscW_ISCW000555
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IscW_ISCW000555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 8025155
NCBI-ProteinID: XP_002408199
VectorBase: ISCW000555
UniProt: B7P620
LinkDB All DBs
AA seq 608 aa AA seqDB search
QFTGSYEVVDHTFDAVVVGAGGAGLRAASGLVEAGFKTACITKLFPTRSHTVAAQGGINA
ALGNMEPDDWRWHIVRVQIQARSGECCEVLYWEAAGLFGCTRRGFHFFRTQEGKIYQRAF
GGQSYNFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSFNCNFFVEYFAMDLLMENGECRG
VLALSMEDGTLHRFRAKNTVLATGGYGRTFFSCTSAHTCTGDGNAMVTRAGLPLQDMEFI
QFHPTGIYGAGCLITEGCRGEGGFLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIRE
GRGCGPDKDYVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGI
PTNYKGQVLTHGEKVVPGLYAAGEAASASVHGANRLGANSLLDIVVFGRACAHTIANLCR
PGDKVPDLPSNAGEESVANLDKLRNANGSLPVAKIRLNMQKTMQQHAAVFRTGESLQEGC
KKMDGVYNELKDLKVSDRGMIWNTDLVEGLELQNLLSCARQAIYAAEARKESRGAHARED
FKDRVDEYNYAKPLEGQQKVPVEQHWRKHTLSDMDTATGKVSLDYRPVIDETLDQKECKM
VPPAVRVY
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
cagttcactggcagctatgaggtggtggaccacacgttcgacgctgtcgttgtgggtgcc
ggaggagccggattgagggcggcttcgggactcgtcgaagccgggttcaagacggcttgc
atcaccaagctctttcccacccgttctcataccgtagccgctcagggaggaatcaatgct
gctttggggaacatggagcctgatgactggagatggcatattgtccgtgtgcagatacag
gcaagaagtggtgaatgctgcgaagtactttattgggaagcagctgggttgtttggctgc
acgcgtcgcgggtttcactttttccgcacccaggagggcaagatctaccagcgtgccttt
ggcggccagtcgtacaacttcggcaagggtggccaggcacaccgctgctgcgccgtggca
gatcgtacaggccactcgttgctccacacgctctacgggcagtcgctgagcttcaactgc
aacttttttgtggagtactttgccatggacctgctgatggagaatggcgaatgtcggggc
gtcctggcactctcaatggaggacggcaccctgcatcgcttccgcgccaagaacacagtc
ctcgccacagggggctatggccgcacattcttctcatgcacttctgcccacacgtgcacg
ggtgacgggaacgccatggtgaccagggcaggactcccgctccaggacatggagttcatc
cagttccatcctacgggcatctacggtgccggctgtcttatcaccgagggatgtcgtggc
gagggcggtttcctgatcaacagcgaaggagagcgattcatggagcgctacgctcccgtc
gccaaagacttggcctcgcgcgacgtcgtctcgagagccatgaccatcgagatccgggag
ggaaggggctgcggtccagacaaggactacgtgtacctgcagctgcaccacctgcccccg
gagcagctggctatgcgcctgccgggcatctcggagacggccatgatctttgccggcgtg
gacgtcacccgcgaacccatcccggttctgcccaccgtccactacaacatgggcggcatc
cccaccaactacaagggacaggtcttgacccacggcgagaaagtggtccccggcctgtac
gccgccggggaggcggccagtgcgtcggtgcacggggccaaccggttgggggccaactcg
ctgctggacatcgtggtgttcggccgggcctgcgcccacaccatcgccaacctttgccgg
ccgggggacaaagtgccggacctaccaagcaacgccggagaagagtccgtcgccaacctg
gacaagctgcgtaatgcgaacgggtcccttccagtcgccaagatcaggctgaacatgcag
aagacaatgcagcagcacgcggcagtgttcaggaccggagagagtcttcaggagggttgc
aagaagatggacggtgtttacaatgaactcaaagacttaaaggtgagcgaccgcggcatg
atctggaacacggacctggtggagggcctggagctccaaaatctactgtcctgcgcccgg
caagccatctacgccgccgaagcacgcaaggagagccggggcgcgcacgcccgcgaggac
ttcaaggaccgcgtggacgagtacaactacgccaagccgctggagggccagcagaaggtg
cccgtggagcagcactggaggaagcacactctctccgacatggacaccgccaccggaaag
gtgtcgctagactaccggccggtcatcgacgaaaccttggaccagaaggagtgcaagatg
gtgccccccgcagtacgcgtctactag

DBGET integrated database retrieval system