KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW003049Help
Entry
IscW_ISCW003049   CDS       T01131                                 

Definition
(RefSeq) soluble maltase-glucoamylase, putative
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00052  Galactose metabolism
isc00500  Starch and sucrose metabolism
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    IscW_ISCW003049
   00500 Starch and sucrose metabolism
    IscW_ISCW003049
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     IscW_ISCW003049
    3.2.1.20  alpha-glucosidase
     IscW_ISCW003049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110 Trefoil
Motif
Other DBs
NCBI-GeneID: 8026021
NCBI-ProteinID: XP_002401557
VectorBase: ISCW003049
UniProt: B7P866
LinkDB All DBs
AA seq 547 aa AA seqDB search
LIGRPFLPPYWALGFQLSKFGYDSLKNLKLVVSRNREARIPMDVQHLDIDYMDGCKTFTV
DNDTYGVMERKEDCESALCLWRESEGHLPKCFQPKDAYGYSISGLDSPINATHVAFNLSH
EKSSYSPFPESAIDVVRFQLIKYNDYIVRFKLSSATESRYEVPVQETFDLLRRPQNISDP
RYVFETGLTPNGYFKFSIRRKGTHTNLIDTGIGGLIMTNQFLQFATYLPSTNFYGFGEHA
HDTLRHHFRFNTVAMFARDESPKESANLYGVHPFYMCIEEGGKAHGLFMLNSNAMEYTLL
RAPALRLTTIGGVLDFFLFVGDSPTHVAQLYSDLIGRPFLPPYWALGFQLSKFGYDSLKN
LKLIVSRNREARIPMNAPFPSTGEYMILDDVTLSTKTPLYVRAGSVIPTQKPGMSTRDSR
KKPFTLLVYPEEGSATGQLFWDDGVSKRTVELNRYDYFVFHVKRCRLTISKTHTNVEPLL
VTLEKIVVMSAFVPTRLYVDGKNRKEAIGKMSDEAFKLTVQLELHDLRRVHVIEWTTESQ
NGTECPK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
ttaattgggcgacctttcttgccaccttattgggcacttggcttccagttgtccaagttc
ggatacgattctctcaaaaacctcaaactcgtcgtctcgaggaaccgggaagcccgcatc
cccatggatgtccaacacttggacatcgattacatggacggttgcaagacgttcacggtc
gacaatgacacctatggagtgatggagcgtaaagaggactgcgagagcgctctctgcctg
tggcgggaatcggagggtcatctaccgaagtgcttccagcccaaggacgcctacggctac
tctatcagcggcctcgattcgccgatcaacgccacccacgtggccttcaacctcagccac
gaaaagagctcctacagcccgttcccagagagcgccatcgacgtggtccgattccaactc
atcaagtacaacgactacatcgtccgcttcaagctaagtagtgccaccgaatctcgatac
gaggttcctgtccaggagacttttgatctgctgaggagaccccaaaacatcagcgacccg
agatacgtcttcgagacgggactcacacccaacggttacttcaagttcagcatacgacga
aagggcacgcacacaaacctgatcgacaccggcatcggaggtctaatcatgacgaaccag
ttcctccagttcgcaacgtaccttccttccacgaatttctacggattcggcgaacacgct
cacgatacgctacgtcaccacttcagattcaacacggttgccatgttcgcccgcgacgaa
tcgcctaaagagtctgccaacctttacggcgtccacccgttctacatgtgcatcgaagaa
ggaggcaaagcacacggactcttcatgctcaacagcaacgccatggaatacacgttgttg
cgagctcccgctctgaggctgaccaccatcggaggggtcctggacttcttcctttttgtg
ggcgacagcccgactcatgttgcgcaactctactcagacttaattgggcgaccttttttg
ccaccttattgggcacttggcttccaactgtccaagttcggatacgattctctcaaaaac
ctcaaactcatcgtctcgaggaaccgggaagcccgcatccccatgaatgcgcctttcccg
agtactggtgaatacatgatcctggatgacgtcacgctgagcacgaagacgcctctttat
gttcgtgctggctcagtgattccgactcagaaaccgggcatgagcacccgagacagtcgg
aagaagccctttacgctgctcgtatatccagaggaaggcagcgcaacgggacagcttttc
tgggacgacggtgtctccaaacggacagttgaactaaaccgctacgactactttgtgttc
cacgtcaaacgctgccgattgacgatatcgaagactcacacgaacgtcgagcctctgctc
gttaccctagaaaagatagtggtgatgtccgcctttgtgcccacgcgcctctacgtcgac
ggcaagaatcgcaaggaggccatcggcaagatgagtgatgaggccttcaaattgacggtt
caactggaactacacgaccttcgtcgagttcacgtcattgagtggacgacagaaagccaa
aacggaaccgaatgcccgaagtga

DBGET integrated database retrieval system