KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006479Help
Entry
IscW_ISCW006479   CDS       T01131                                 

Definition
(RefSeq) glutathione S-transferase, putative
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00480  Glutathione metabolism
isc00980  Metabolism of xenobiotics by cytochrome P450
isc00982  Drug metabolism - cytochrome P450
isc00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IscW_ISCW006479
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    IscW_ISCW006479
   00982 Drug metabolism - cytochrome P450
    IscW_ISCW006479
   00983 Drug metabolism - other enzymes
    IscW_ISCW006479
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:isc02000]
    IscW_ISCW006479
Enzymes [BR:isc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     IscW_ISCW006479
Transporters [BR:isc02000]
 Other Transporters
  Pores ion channels [TC:1]
   IscW_ISCW006479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C
Motif
Other DBs
NCBI-GeneID: 8051547
NCBI-ProteinID: XP_002435664
VectorBase: ISCW006479
UniProt: B7PPH2
LinkDB All DBs
AA seq 245 aa AA seqDB search
MSSHINSFRFAVSFLGMEFPSLAPGKLRVYITRFCPFSHRTLLMLRAKNLAHEVVNVDLN
NKPEWLFKLNPAGTVPILQQDDKILYDSTVVPEYVDEAYGQEKLIPTDPYLKAKEKLFID
AATTALRPVVRVHRDVDKKVELWDKFKQGVQFHEEELKARRTLFLSGEKPGFSDYMIWPF
FARAIAISTVFPDLKLPTAQESPLVVRWMEAMKKDGASGALPPEDNFVKYIKSSLAGNAD
PDVGL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcatattaattcctttcgatttgcggtttcttttctaggaatggagtttcct
tcgttggcgcccggaaaacttcgagtgtacatcacgagattctgccccttcagtcatagg
acgctcctaatgctgcgtgctaagaacttagcgcacgaagtggtaaacgttgatctcaac
aacaagccagaatggcttttcaagctgaaccccgccggcacagttccaatccttcagcaa
gatgacaagatcctctacgattccacggttgtgcctgagtacgtcgatgaagcctatggt
caggagaagctaatacccaccgacccctatctcaaggcgaaggaaaaactttttattgat
gctgctaccacggcacttagaccagtggtccgggttcatagggacgtggataagaaagtt
gagctctgggacaagtttaagcaaggtgtgcagtttcacgaagaagaactgaaggcaaga
agaactctcttcctctcaggagaaaaacccggattttctgactacatgatctggccgttc
ttcgcaagggcgattgcaatttcaactgtcttccccgatttgaagctgccaaccgctcaa
gagtccccactggtcgtcaggtggatggaggcgatgaagaaagatggcgcttctggcgcc
cttccgcccgaagataatttcgtaaaatacataaagtcctccctggctggaaacgctgat
cccgatgtggggctataa

DBGET integrated database retrieval system