KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006570Help
Entry
IscW_ISCW006570   CDS       T01131                                 

Definition
(RefSeq) glycogen synthase, putative
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00500  Starch and sucrose metabolism
isc01100  Metabolic pathways
Module
isc_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IscW_ISCW006570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:isc01003]
    IscW_ISCW006570
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     IscW_ISCW006570
Glycosyltransferases [BR:isc01003]
 Polysaccharide
  Storage polysaccharide
   IscW_ISCW006570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 8052116
NCBI-ProteinID: XP_002435763
VectorBase: ISCW006570
UniProt: B7PPS1
LinkDB All DBs
AA seq 642 aa AA seqDB search
MAENCLARIPCPAGGIYTVVRSKAVLDSVIVGGIYTVIRSKAEVTVEELGDQFCLIGPYN
ENLVRTEVEVLEPPYSIFWNSVKALKEQGIKVVYGRWLIDGYPQVLLFDIGSAAWKLDEW
KRDLWNTCNIGVPWHDRESNDAIIFGYLVAWFLSDVMTAEKGPPFVVAQFHEWLAGIGLM
LCRTRHLDVATVFITHATLLGRYLCAGNVDFYNNLDKFSLDKEAGDRGIYHRYCMERAAC
HSAHVFATVSEVTAMEAEHLLKRKPDAITPNGLNVKKFSALHEFQNMHAIAKEKIHDFVR
GHFYGHYDFDLDKTLYCFIAGRYEFSNKGADLFIESLARLNHYLKSSGSEVTVIAFLIFP
AKTNNFNVESLRGQAISKQLRDTVQQMQSTIGKRMFEICLSGKIPKGEELIYSEDLVRLK
RCIYASQRTTLPPVCTHNMLDDSSDPVLCHIRRCQLFNRREDRVKVIFHPEFLSSTNPLF
SMDYEEFVRGCHLGIFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFIAEHVADPMSYG
IYIVDRRFKSAEESVQQLAQYMFDFSCLSRRQRIIQRNRTERLSDLLDWKNLGISSKLQL
RYPRPMSEPPSPSASRTSTPAPSEHGSDEEEDSDEGEELKHT
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaattgtcttgcacgcatcccatgtccagctggaggtatctacacggttgtc
aggtccaaggctgtcctggacagtgtcattgttggaggcatctacacggtcatcaggtcc
aaggcagaggtgacagtggaggagttgggtgaccagttctgtctcatagggccttacaat
gaaaacctggtgcgcaccgaagtggaggtcctggagccgccttacagtatcttctggaac
agcgtcaaggccctgaaggaacaaggcatcaaggtggtgtacgggcggtggctaattgat
ggctacccgcaagtgctgctgttcgacattgggtcggcggcgtggaaactggacgagtgg
aagagggatctctggaatacgtgcaacattggggttccctggcacgaccgggagtctaac
gacgccatcatttttggctacctagtcgcatggttcctctccgacgtaatgacagcggag
aagggcccgccatttgtggttgctcagttccacgaatggctagccggcattgggctgatg
ctctgccgcaccaggcaccttgacgttgcgacggtcttcatcacgcacgccacgctcctc
ggaaggtacctctgcgccggcaatgtggatttttacaacaacctcgacaagttcagtctc
gacaaggaagcgggagaccgaggcatctatcaccgctactgcatggagcgagcggcttgc
cacagcgcgcacgtctttgccaccgtctccgaagtgactgccatggaagctgagcacttg
ctgaaacgaaagccagatgctatcacgccaaacggcctcaacgtcaaaaagttcagtgcc
ttgcacgagttccaaaatatgcacgccattgccaaagaaaagatccacgacttcgtacgg
ggccacttttacgggcactatgactttgacctggacaagactctgtactgcttcattgcg
ggtcgctacgagttctcaaacaagggggccgacctgttcattgagtccctggctcgcctc
aaccattatctcaagtcttcgggaagtgaagtcacggtcatagccttcctcatcttccct
gccaaaaccaacaacttcaacgttgagtcgttgcgtggacaagccatctctaagcagctg
cgggacacagtgcagcaaatgcagtcaacgatcggcaagcggatgtttgaaatctgcctg
tcgggcaagatcccgaagggggaggagctcatctactctgaggacctagttcggctcaag
cgctgcatctatgcttctcagcgcacgacgttgccgcctgtctgcacacataacatgctc
gacgactcgtcggaccccgtgctttgccacatccggcgctgccagctctttaaccggaga
gaagacagggtcaaggtcatcttccacccggaattcctgtcttcaacgaatccactgttc
agcatggactacgaggagtttgtgagaggctgccatctagggatctttccctcttactat
gagccttggggatacacccctgctgagtgcaccgtcatgggcatacccagcgtcacaacc
aacctctctggcttcggctgcttcatagcagagcatgtagccgacccaatgtcgtacgga
atctacatagtcgacaggaggttcaagagtgcggaggagtccgtgcagcagttggcgcag
tacatgttcgacttttcgtgcctgtcccggcgccagaggatcatccagaggaatcggacg
gaacgtctaagtgacctcctcgattggaagaaccttggaatatcctccaagctgcagctc
cgctaccccaggcccatgtccgagccgccatcccccagcgcctcgcgaacgtccaccccg
gccccgtcggagcacgggagcgatgaggaagaggatagcgatgagggggaagagctcaag
cacacatga

DBGET integrated database retrieval system