KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007158
Entry
IscW_ISCW007158   CDS       T01131                                 

Definition
(GenBank) rassf1, putative
  KO
K09850  Ras association domain-containing protein 1
Organism
isc  Ixodes scapularis (black-legged tick)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-ProteinID: EEC09975
VectorBase: ISCW007158
UniProt: B7PTQ3
LinkDB
AA seq 418 aa
MSTSEAQKEYTPKFLTPPVTPKKGIAYQENRLRQGFSPSLFLQNFNFPLPFRKKKPKQNS
NTSGFPTPYRTLYHPRIARPKTFRRSEFIELANFGVVEIEPTESGIGHNFEPVQFKNPTW
CDRCGDFVWGACSSQQCLQCLNCSFTCHLRCQDLVTLDCKGRGEMETKDLNTPSSGSSDE
QKNGQNGRLSPLFPEDLPKDELLSRITSYNHQDPGLEMILQEDGSVRGFVRVRMNLMRPI
NVLAGTRPPSIYNILKEEEDSGRKTLTSFYLPKDTIKALHITSEYTARELIVALLKKFKV
ADNPHKFALYESCLDEESKEVKLRKLQDTEKPLWLALDWSSRAKQFVLQENDNSDIEWED
FALPELQNFLKILDLEEEEYLSQLRLKYQIMREKIQEAMDAFQSQDAQQSDESAQSTS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtccacgagcgaggcccagaaggagtatacgccgaagtttctgaccccgcccgtgaca
cccaaaaagggcatcgcgtaccaggagaatagactcaggcagggcttcagccccagtctg
ttcctccaaaatttcaacttccctctcccattccgcaagaagaagcccaagcaaaactca
aacaccagcggctttccaacaccatatcggacgctgtatcacccaaggattgcacggcca
aaaacattccgacggtcggagttcattgagcttgccaatttcggagtggtggaaatcgag
ccgacggagagtggaatcggccataactttgagccagtgcagttcaagaatccaacctgg
tgtgaccggtgcggagactttgtctggggcgcctgctcatcccaacagtgcctccaatgc
ctgaactgcagtttcacgtgccacctcaggtgtcaggaccttgtcacactagactgcaaa
ggtcggggtgagatggagacaaaagacttgaacactccatcctcaggatcatctgatgag
caaaaaaatgggcagaatgggcgtttatctcctctgtttcctgaggatctgccaaaggat
gagctgttgtctagaatcaccagctacaatcatcaggatccagggcttgagatgattctg
caagaagatgggtccgtacgtggttttgtgcgagtgcgcatgaatctaatgcgcccgatc
aatgttctggctgggaccaggccgccgtccatttacaacatccttaaagaagaggaggat
agcggcaggaagacgctgacatctttttacctgcccaaggacaccatcaaagccctgcac
attacaagcgaatacactgcccgagagttgatagttgccttgctgaagaagttcaaggtg
gcagacaatcctcacaagtttgcactttacgaaagctgccttgacgaggagtcaaaagaa
gtgaaactgcggaaactgcaagatactgaaaagccactctggcttgcactggactggagc
agtcgtgccaagcagtttgttcttcaggaaaatgacaacagtgacattgagtgggaggac
tttgcactaccagagctacaaaactttttgaagattctggacttggaagaggaggaatac
ctaagccagttaagacttaaatatcagataatgcgggagaagattcaagaagccatggat
gcttttcaaagtcaagacgcgcaacagtctgacgagtctgctcagtcaacttcttga

DBGET integrated database retrieval system