KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW008219Help
Entry
IscW_ISCW008219   CDS       T01131                                 

Definition
(RefSeq) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:isc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    IscW_ISCW008219
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     IscW_ISCW008219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 8031487
NCBI-ProteinID: XP_002405905
VectorBase: ISCW008219
UniProt: B7PUC4
LinkDB All DBs
AA seq 154 aa AA seqDB search
MSVKAVCVLKGSEKTTGTVYFTQAGPNQPVVVTGEITGLEQGLHGFHVHEFGDNTNGCTS
AGPHFNPLGKEHGAPTDTNRHVGDLGNVIAGDDGVAKVAITDSQISLSGPHSIIGRSVVI
HADPDDLGKGGHELSKTTGNAGARLACGVVGVTK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaaaggctgtttgtgttctcaagggctcggagaagaccaccggaaccgtttat
ttcactcaagcgggcccgaaccagccagtcgtggtcacgggggaaatcaccggcctggag
caaggccttcacggcttccacgtccatgagtttggggacaacacgaacggttgcacgagt
gcgggtccccatttcaatccgttgggcaaagaacatggtgcacctaccgacacaaacagg
catgtcggagacctgggcaacgtgattgctggtgacgacggtgtagccaaggttgccatc
actgattcccagatcagtctttctggaccgcacagcattattggacggtctgtcgtaatt
cacgctgacccagacgaccttggaaagggaggacacgagctgagcaagaccactggcaac
gctggtgcccgccttgcctgtggcgtagttggtgtcaccaagtag

DBGET integrated database retrieval system