KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW009765
Entry
IscW_ISCW009765   CDS       T01131                                 

Definition
(GenBank) cyclin-dependent kinase inhibitor, putative
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    IscW_ISCW009765
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-ProteinID: EEC13337
VectorBase: ISCW009765
UniProt: B7Q3B5
LinkDB
AA seq 165 aa
MAIRVDLGRIPMSRTLLRVGAPRSPRSVKRCLFDAVDHGDVRRQLAKESDARLDRFRRQY
NFDLRTETPLPGRYDWNDSPVSTTTTIQARDAVASDATQEVRPAAIASQVPVTSERRESE
SRQVSITAFFQSRKRRSQEPDKMTSPVPSKVLRQRALPQFPMGGQ
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcgattcgcgtcgatctcggcaggattccgatgtcgaggaccctgctgcgtgtgggt
gctcctcgctcgccgcgttccgtcaaacgctgcctcttcgacgcggtcgaccacggcgac
gtgagacgccaactcgccaaggagagcgacgcacggttggatcgcttccgccgccagtac
aacttcgatctgcgcaccgagacgccgctgcccggacgttacgactggaatgattcaccg
gtgtcgacgacgacgacgattcaagctcgcgacgccgttgctagcgacgccacccaagag
gtgcgaccggcggcgatagcgtcgcaagtgcccgtcacctccgagcgtcgcgaatcggaa
agtcgacaagtttctatcacggcattcttccagagtcgcaagaggcggtcgcaagagccg
gacaagatgacgtcaccggtgccgtccaaggtcctccgccagcgggcgctgccgcagttt
ccgatgggcggccaatga

DBGET integrated database retrieval system