KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW011416Help
Entry
IscW_ISCW011416   CDS       T01131                                 

Definition
(RefSeq) glycosyl hydralase, sucrase-isomaltase, putative
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00052  Galactose metabolism
isc00500  Starch and sucrose metabolism
isc01100  Metabolic pathways
isc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    IscW_ISCW011416
   00500 Starch and sucrose metabolism
    IscW_ISCW011416
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    IscW_ISCW011416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:isc04147]
    IscW_ISCW011416
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     IscW_ISCW011416
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IscW_ISCW011416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 8037543
NCBI-ProteinID: XP_002412387
VectorBase: ISCW011416
UniProt: B7Q8N5
LinkDB All DBs
AA seq 734 aa AA seqDB search
RFDCHPEGNASETSCLLRRCCWGVLDNTVDETVENSVGVPRCFFPKHYLGYSVQGAQSSI
DRITVQLKRRTPSGIDVDVPLVQVQVLFYDRNTVRIKVLDPSVQRFSPPVPSIRDQTFSG
LCEYGVNFSDADGKIRVYRFESPDIVLFQTDLSRLVFTDQFLQLSTTMPSSTVFGLGEQW
GHLRRDTNWTRHVFFNRDRGPVENENLYGTHPVYLGLEQDGKGHGVFLHNSNAMEVFLQP
TPAATFRATGGILDMFVFVGPSPTKVVQQLQHVVGFPAMPPYWGLGFHLCRFDYGSLNRT
RFIMEKNIQAGIPLDTQWNDIDYMNDGNDFTYDPHQFRGLPEFVDELQAGGRHYVIILDP
AVSGSEPAGTYPPYDRGMELDVFVKNASGSVVYGKVWNANSSVFPDFSHPRAEEYWISQF
KNFHDVVPFDGAWIDMNEPSVFYNGHAGGCPEDSRLEHPPYVPGGESLSVKTLCMSDLHH
ISAHYDVHNIYGHLEARATYKALATIRQKRPFVISRATSPGQAAWSGHWSGDIESSWKDL
RLSVPNVLSFGLYGIPLVGADICGFNSNTTVELCARWQALGAFYPFSRNHNTNDAMDQDP
YSMGPVVLDAARRTLMMRYTLLPYLYTLFYRSHVLGETVARPLFMEFPQDPSTYDIDEQF
LWGPGLMFNPALYENQTEVNAYVPAGVWFDLDRGTPYHHPEGRYRTFPSPLNVVNILIRG
GFVVPGQEPALTTT
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
cgctttgactgtcaccccgaagggaacgccagcgaaacctcctgtctcctacgccgctgc
tgctggggggtcttggacaacacggtggacgagacggttgagaacagtgtcggggttccg
cgatgcttcttccccaaacactacctgggctactccgtccagggtgcccagagctccatc
gatcggatcaccgtccaactcaagcgacggacgccgtccggcatcgacgtcgacgtgccg
ctcgttcaggttcaagtgctcttttacgatcggaacacggtcaggataaaggtcctggat
ccgtcggttcagcgcttctctcctccggtgcccagcatccgcgaccaaaccttctcaggt
ctctgcgagtacggcgtcaacttcagcgacgccgacggaaaaattcgggtctatcgcttt
gaatcaccggacattgtccttttccagacagacctatcgagactggtgttcaccgaccag
ttcctccaactttcaacaacgatgccttcgagtacagtgttcggcctgggcgagcagtgg
ggccacctacgcagagacaccaactggactcggcacgtgtttttcaacagagaccgaggg
cccgtggaaaacgaaaacctctacgggacgcatccggtttatcttggacttgagcaggac
ggcaagggccacggcgttttcctgcacaacagcaacgcgatggaggttttcctacaaccg
actccggcagccaccttccgcgccaccggtggcatcctggacatgttcgtcttcgttggc
ccatccccgaccaaggtggttcagcagcttcagcacgtggtcggctttcccgccatgccc
ccttattggggcctgggcttccacttgtgtcgttttgactacgggtcgctgaacaggacg
cgcttcatcatggagaagaacatccaggctggaatcccattggacacgcaatggaatgac
atcgactacatgaacgatggaaacgacttcacctacgaccctcaccagttccgtggactc
ccagagtttgtggacgagctgcaggccggtggccgtcactacgtcatcatcctcgaccct
gcagtgagcggctcggaacctgcaggaacgtatcctccctacgaccgaggcatggaactg
gacgtttttgtgaagaatgcctctggaagcgtcgtgtacggaaaggtttggaatgccaac
agcagcgtgtttcctgacttttcacatccgagggcggaggaatactggatctcgcagttt
aagaacttccacgacgtggtgccatttgatggagcctggattgacatgaacgagccgtcc
gtcttctacaatggccatgccggcggatgtcccgaagacagccgcctcgaacatcccccg
tacgtccctggaggagaatccctttctgtcaagactctgtgcatgagcgacctccatcac
atctcggcgcattacgatgtgcacaacatctacggacacctagaggccagagcgacctac
aaggctctggcgactattcgacagaagcggccattcgtcatttcacgtgcgacgtccccc
ggacaggcagcgtggtctggacactggtctggagacattgagtcgtcctggaaggacttg
aggctaagcgtaccaaacgtgctgagtttcggactgtacggcatacccctggtcggtgcg
gacatctgcggcttcaactccaacactacggtggagctctgcgctcgttggcaagcccta
ggagcgttctaccccttctccagaaaccataacaccaacgatgcaatggaccaagatcca
tacagcatgggacctgtggtgcttgacgcagctcgaaggaccctgatgatgcggtacacg
ctcctgccttacctgtacacactcttctacaggagccacgtcctaggcgagaccgtcgca
aggccgttgttcatggagttccctcaagatccaagcacatacgacatcgacgagcaattc
ctctggggaccgggcctgatgttcaacccggcattgtacgaaaaccagacggaagtcaat
gcatacgtcccggccggtgtatggtttgacctcgatcgcggaacaccgtaccatcatccc
gagggccgctaccgaacctttccttcgcccttgaacgtcgtgaacatcctgatacgcgga
ggtttcgttgttccgggccaggagccagccctcaccacgacc

DBGET integrated database retrieval system