KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW015237Help
Entry
IscW_ISCW015237   CDS       T01131                                 

Definition
(GenBank) fatty acyl-CoA elongase, putative
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00062  Fatty acid elongation
isc01040  Biosynthesis of unsaturated fatty acids
isc01100  Metabolic pathways
isc01212  Fatty acid metabolism
Module
isc_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    IscW_ISCW015237
   01040 Biosynthesis of unsaturated fatty acids
    IscW_ISCW015237
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:isc01004]
    IscW_ISCW015237
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     IscW_ISCW015237
Lipid biosynthesis proteins [BR:isc01004]
 Elongase
  PUFA
   IscW_ISCW015237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-ProteinID: EEC20301
VectorBase: ISCW015237
UniProt: B7QN79
LinkDB All DBs
AA seq 159 aa AA seqDB search
MIASLNPITLSNKIQQMGDPRTRDYPVVMSPLFVFPMILSYLYFVRVAGPRWMKNREPFK
IVNIIRLYNLIMVYLNAKFLVALLGLTYLPGGRYSLWCQGITGYMDDDFERFYKFGWFFV
SVRYADFLDTVFFVLRKKFTQITHLHVIHHTIVAATLYV
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgattgccagcctgaacccgatcaccctgtcgaacaaaatccagcagatgggagacccc
agaaccagggactaccccgtggtcatgagccccttgtttgtcttcccgatgatcctctcc
tatctgtacttcgtcagggtggctggcccccggtggatgaagaacagggagccatttaag
attgtgaacattattcgcctctacaacctcatcatggtctacctaaacgccaagttcctc
gtcgcgttgctaggcctaacgtacctaccaggaggacgctacagtctctggtgccaggga
atcaccgggtacatggacgatgacttcgaaagattctacaagttcggctggttcttcgtc
tcagttcggtacgccgacttcttggacaccgtgttctttgtcctacgaaagaagtttacg
cagatcacgcatttgcacgtcattcaccacaccatcgtggcggcgacgctgtacgtttga

DBGET integrated database retrieval system