KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW022542Help
Entry
IscW_ISCW022542   CDS       T01131                                 

Definition
(RefSeq) sorbitol dehydrogenase, putative
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00040  Pentose and glucuronate interconversions
isc00051  Fructose and mannose metabolism
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IscW_ISCW022542
   00051 Fructose and mannose metabolism
    IscW_ISCW022542
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     IscW_ISCW022542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 2-Hacid_dh_C Pyr_redox_3 TOBE_2
Motif
Other DBs
NCBI-GeneID: 8038403
NCBI-ProteinID: XP_002412610
VectorBase: ISCW022542
UniProt: B7QAN4
LinkDB All DBs
AA seq 353 aa AA seqDB search
MAAEGADNLSAVLYKKDDLRLEQRPVPEPGDNDVQIRVHSVGICGSDVHYWVHGNIGNFV
VREPMVLGHETSGTVSKVGKNVKHLKPGDRVAIEPGVPCRYCEFCKTGRYNLCPDVFFCA
TPPDHGTLTRYYTHPADFCFKLPDHVSFEEGALLEPLSVGVHACRRSHLSLGQTVLICGA
GPIGLVCLLTAQAMGASKVVITDIVDNRLERAVQLGASSAINVAAKSVDDIKREIVNALG
DLPDVSIECTGAEASIQIGMLGTKSGGTLVLVGLGPNEVKVPLVDAAVREIDIRGIFRYV
NCYPTALAMVASGKVDVRSLVTHRFRLESAADAFRVAKTGEGGAIKVMIQCDN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgaaggcgccgataacctgtcggctgtgctctacaaaaaagacgatcttcgt
ttggagcagaggcctgttcccgagcccggagataacgacgtgcagatccgggttcattcg
gtgggcatctgcggctcggacgtgcactactgggtccacggcaacatcggcaacttcgtc
gtccgtgaacccatggtgctgggccacgagacgagtggcacagtctccaaagtgggcaag
aacgtcaagcacctcaagccaggtgaccgcgtggccatcgagcccggggtgccctgccgc
tactgcgagttctgcaagacgggccgctacaacctgtgcccggacgtcttcttctgcgcc
actccgcccgaccatggcaccctcaccagatactacacacaccctgccgacttctgcttc
aagttgccggaccacgtgtccttcgaagagggggccctccttgagccgctctctgtggga
gtccacgcttgtcgcaggtcccacctgagccttggccagacggtgcttatctgcggagca
gggcccattggtttggtctgccttctgactgcccaggccatgggagccagcaaagtggtc
atcacagatattgtggacaacaggctggagagggctgtccagctaggcgccagcagtgcc
atcaacgtggccgccaagtcagtggacgacatcaagagggagatagtgaacgctctcggc
gaccttccggacgtctccattgagtgcaccggagccgaagccagcatccagatcggaatg
ttgggaaccaagtccggcgggacgttggtccttgtcggcctggggcccaacgaggtgaag
gtgccacttgtggacgccgccgtccgggaaatcgacatccgcgggatcttccgatacgtc
aactgctacccaacggccctggccatggttgcgtccggcaaagtggacgtgaggtctctg
gtgacgcatcgcttcaggctggagtctgccgcggacgccttcagggttgccaagacggga
gagggaggggccatcaaggtcatgattcagtgcgacaactga

DBGET integrated database retrieval system