KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW022710Help
Entry
IscW_ISCW022710   CDS       T01131                                 

Definition
(RefSeq) lysosomal alpha-glucosidase, putative
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00052  Galactose metabolism
isc00500  Starch and sucrose metabolism
isc01100  Metabolic pathways
isc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    IscW_ISCW022710
   00500 Starch and sucrose metabolism
    IscW_ISCW022710
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    IscW_ISCW022710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:isc04147]
    IscW_ISCW022710
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     IscW_ISCW022710
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IscW_ISCW022710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Trefoil Gal_mutarotas_2 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 8039820
NCBI-ProteinID: XP_002413757
VectorBase: ISCW022710
UniProt: B7QDZ3
LinkDB All DBs
AA seq 667 aa AA seqDB search
RLFSSCAFIMYHQTFSGSLAECQLERLSERFDCHPVVASNEDACLSRGCCWKPLNETMLD
ERTAIPSCYFPKDYAGYAVTRTETSTDRVTLHLERKIPSGIDVDIRAVRVELLFYDQNTL
RIRTLGTTEKRFVPPVPRIPSRTFAGDRQYTVTFNETNGEIKVHRRGTPDTVMCTFYEPL
HCQTRDVLFFFLRNEKFILVHLPLLTMLERSESVSTLWERIECLAVNRNMYGSHPFYIGV
ERDGKSHGVFLHNSNSIEVVLQPTPAATFRTIGGILDIFVFVGPTPAKVVQQYQHVVGLP
ALPPYWSLGFHLCRYEYGSLDRTRFIMEKNIEAQIPLKTIFMLFYSTRRFLYFNMYSKKT
LILKQFSKIFLKRSLHMSNKDPAMSGSEIPGTYPPFDMGIDMDIFVKNESGGVVYGKVWN
DKSSVFPDFSHPRANEYWGSLFKRFHEVVPFDGAWIDMNEPTNFYDGHADGCPPNNTLDY
SPYVPGEKPLFAQTLCMSDRHHLSAHYDVHNIYAHLEAEATYTALAGIRGKRPFIISRAS
STGMGAWSGHWSGDIASSWGDMRLTIPNMLSFGMYGMPLVGSDICGFRGNSSLELCARWH
VLGAFYPFSRNHNDYDCVDQDPYSMGPLVIEAARTSLRMRYSLLPYLYTLFYRSHVFGET
VARPLFF
NT seq 2003 nt NT seq  +upstreamnt  +downstreamnt
cgcctcttttcttcttgcgccttcatcatgtatcaccaaaccttttcaggcagccttgca
gaatgccaattggagagattatctgagaggttcgactgccatcccgtggttgcctccaat
gaagatgcctgtctttcccgtggttgttgctggaagccactcaatgaaaccatgttggat
gagaggacggctattccgtcatgctactttcccaaagactacgcgggctacgcagtgact
cgcaccgaaacctcgacggaccgggtcacccttcatctcgagagaaagatcccgtcgggt
attgatgtcgatattcgagctgttcgtgtggagctgctcttttacgaccagaacaccttg
aggattaggactttaggtactacggagaagcgctttgttcctcctgtgcctcggattccg
tccaggacgtttgctggagaccgccagtacactgtcaccttcaacgagaccaatggggag
attaaggtgcaccgccgtggaacacctgatacagtcatgtgcacattttacgaacctttg
cattgccagactcgtgatgtattatttttttttctgagaaatgaaaaattcattttagta
catctgcctctacttactatgttagagaggagtgagagtgtatcaacattgtgggagcgt
attgagtgtttagcagtaaacaggaacatgtatggctcacatcctttctatatcggagtg
gaacgtgatggaaaaagtcacggagttttcctgcacaacagcaattccatcgaggttgta
ctgcaaccgacaccggcagccacattccgcaccatcgggggcatcctggacatcttcgtt
ttcgtcggaccgaccccagccaaggtggtgcaacagtaccagcacgtggtcgggctgccc
gccctgcccccttactggagtctcggcttccacctgtgtcgttacgagtacgggtcgctc
gacaggacgcgtttcatcatggagaagaacatcgaagcgcagattcctctgaagactatt
tttatgcttttttattcaactcgccgttttctttactttaatatgtattctaagaaaacc
cttattctaaaacaattttcgaaaatatttttgaagcgttcccttcatatgtctaataaa
gaccctgccatgagtggctctgagattcccggaacttatccgccctttgatatgggcata
gatatggacatttttgtgaagaacgaatccggaggagtggtgtatggaaaggtatggaat
gacaagagcagcgtctttcctgacttctcccacccaagggccaatgaatactggggttcc
ctgttcaagagatttcacgaggttgtgccctttgacggagcttggattgacatgaacgaa
ccgaccaacttttacgacggccacgccgacggttgtcccccaaacaacacactggattat
tctccctacgttcctggggagaaacctttgttcgcgcagaccctctgcatgagcgaccgc
caccacctctcggcccattacgacgtccacaacatctacgctcatctggaagccgaagcg
acgtacactgctctggcgggaattcgaggaaagcggccgttcattatttcgcgggcgtca
tcgacgggtatgggtgcctggtcgggccactggtcaggagacatcgcatcgtcctggggg
gacatgcggctaaccataccaaacatgctgagcttcggcatgtacggcatgccactggtg
ggttctgacatctgcggcttccgcggcaacagctctctggaactctgcgctcgatggcat
gtcctcggggctttctacccgttctccaggaaccataacgattacgattgtgtggatcag
gatccttacagcatggggcctctggttattgaggcagctcgtaccagtctacggatgcgc
tactccctcctgccgtacctctatacgctgttctacaggagtcacgtctttggtgagacc
gtcgccaggcccctcttttttga

DBGET integrated database retrieval system