KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023198Help
Entry
IscW_ISCW023198   CDS       T01131                                 

Definition
(RefSeq) glutathione S-transferase, putative
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00350  Tyrosine metabolism
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    IscW_ISCW023198
Enzymes [BR:isc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     IscW_ISCW023198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 8043486
NCBI-ProteinID: XP_002416387
VectorBase: ISCW023198
UniProt: B7QMI2
LinkDB All DBs
AA seq 227 aa AA seqDB search
QTLLFFFFFFQPILYSYFRSSCAYRVRIALALKNVEYEQKTVNLMKDGGEQKSAEFTERN
PMQQVPVLEVNGEPLFQSLAIIEYLEEKYPEPSLLPKDLVLRSKVRAIAELIASGIQPLQ
NIGILFKLEQSKRNEWAVEFISKGFQALEAVLAKTAGKYCVGDSVTMADACLVPQVYNAK
RFKVDLAPYPTIVRVNNTLEKLEAFKAAHPCCQPDTPEELKDPSKHF
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
caaacacttctttttttcttttttttttttcagcctattttgtactcttattttcggagt
tcctgcgcttacagggtgcgaattgcattggccttaaaaaatgtggaatatgaacaaaag
acagtcaatttgatgaaggatggaggggaacagaagtctgcagagtttacagaacggaac
ccgatgcaacaggtcccagtgcttgaggtcaacggtgaaccactgttccagtcgctcgcc
atcattgagtaccttgaagaaaaatatccggagcccagcttgctgccaaaagatcttgtc
ttgcgctcaaaggttcgtgctattgcagagctgattgcatctggaattcagccccttcag
aacattggcatactcttcaagctggagcagagcaagcgaaatgaatgggcagttgaattt
atctccaagggtttccaagctctggaagcggtgctcgccaagactgcgggcaaatactgc
gtgggagacagcgtcaccatggccgatgcttgcctggtgcctcaagtttacaacgccaag
cgcttcaaggtggacttggctccgtacccgaccatcgtgcgggtaaacaacactcttgag
aaactggaggctttcaaggctgcccacccatgctgccagccagacacgccggaagagctc
aaagatccctcgaaacatttttga

DBGET integrated database retrieval system