KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023206Help
Entry
IscW_ISCW023206   CDS       T01131                                 

Definition
(RefSeq) hypothetical protein
Organism
isc  Ixodes scapularis (black-legged tick)
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC FYRN zf-HC5HC2H_2 zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 8043310
NCBI-ProteinID: XP_002416245
VectorBase: ISCW023206
UniProt: B7QM40
LinkDB All DBs
AA seq 1916 aa AA seqDB search
MTTSMPSGMGPNTVSNAGPGMGQNMGPNMGPGMAPNMGAMGSAAPQQHIISVSTSGGGMA
PLGGPPQSPMPPPSSPMGGPSPSPRMQQPPTSPLPVPSPLLSQMSPQLPSPRTPRPPNTH
PLSQLQQQHQMQQMLIKREDGSLGVPHGLRMSPHMAPRPFQQHEQQQHILLHPRFPGQPQ
MPRYLIRQGSDPASQHPPGHPYLQRTGGVHPMMRPPPPYPDHLRKPPPSPAMSPGHGPDG
GDNPDPSRTPPSLSRPNSQPALPSPDPRSSPMERHFSPGTPSSSSSLPQRSPAVPTSLAD
DARGDVGERSVESLSDLLSRVSKTPSESPSPQSRGEEGRPSTGEPSPGRGCGSQDNSGQT
PPLSKQESILQYLRAGSVGSPASNSNSSRGSVDSFAGVAGGQAMCSVAESRATESPHYVP
ASVYQSAGASPVGSPSPSAFAAQSQSMSTGDAFASDGSDSSSPMQVRTQMVRVSQGMMGL
PTTTYVQQIRQQQQQMMLQQSQYVPQQGMAIRRPPAQSPRGSVPFGDSQFVRAQMFRAAA
PANANVARNFVVRPGGNNPPGSGGGLRGGRPHTVGGGRGAVPASPPKASSSSGDEGEGAS
STPSLLHRAGEGGSSSFGGSTFHVGPSSTLVSFETEQMQTSVFVSLDYPAATITSHDGLR
LDEEDGDASRVALVMVGDGDGGQPDAVEHGEPLDVAVVVETVGALSDCDPGDDGSSPGGS
DGADGMAPPGCGELHQRGTPAGDHNYSNPPPEGADEDVAKKLVGRTQFFDGVDVGIKLED
SVLGCISEEKPNIEKLLSERITPPQRASKTPSPPAAPVATSAMSFPASVTHTLNFTLRQT
GMPQTVRLSNDEGQLVVLPGKAMATQLSLSPPAVACEPPVTPKMEPASALTPPAMLRVHA
ALAAPPSSACGSHAAGLRWCRTPPEVKEEGTPSVPPTPPPALPPVVVKQEARSTPSPCLA
ACHKQESEDVEEGSVEAADTGASRLTDGAAVPRTESNSCDDGVPPEQRLALPVTPPVATP
TLPVALMAKDTAAALAAVKVEPTVAAVAVSEAQAGAAEEASAPKACEGSVEGPDGPTGGK
QNVLLKQLLQNCPSAETPHVADLPEGAPTVQTACSGKSENGTGELSQTASLSPSLPSSPS
SQPATTTAETAVTTTAVPASAPVNELDVPATTVGTPESQTVVGVAGTQAGATTTPDTDKP
EESKGSRGGPEEDYELFLEALLGRLRALPPVRILEPLIRPNFNVGVVFGRGDLNLRESSL
KGSYGRAFLPGQPDAYSVCPFGDRPPPPVAPSSAATPSPTPLRGFYNQEFSVHARVTSGG
ADSNRCREADSPDTIVGASSPECAMFEAPFRFRGLQLIDEDSNDSARSLPSPTVPIVAPI
PVKDEKTKEIAFSGDRLPCFSRLAGCGGLLRQTLRDSPNVSVTLTLSSEAATDIRGVLCF
LVKLAADRAPVELRHRGAHEHPSPARSWGSTSTEATVVCHAGRGDHPCREAPDSSRDRLA
RGVAAAREVVRALGEDDEASPAPKEEEGEEEEEEEEGRLLGDLEGSPASEELRKRAPKHS
LALHREQLLDAQDICVKPDKPVEDTRRCILCHVVGDGETNGPARLLNLDVDMWVHLNCAL
WSQEVYETVNGALMNVASACRRAVLLTCCCCQRTGASLRCFRLRCTAAYHFPCAAKDGCS
FFKDKTILCPQHTPRVPNLENVLESVAVFRRVYINRDEHKQVASMIHKGEQNLLRVGSLI
FLSVGQLLPHQLQNFHTPNCIYPVGFKVVRIYWSMHKLGARSRYTCSIHDVDGQPQFQVR
VSSGGHEKILSHRTPKGVWQKVLQPIENFRREAQAIKVFSNFITGEDLFGLTEPAIVRIT
ESLPGVDTLNDYNFRYGRSPLLELPLAINPTGCARSEPKLRTHFKSTEADTAGVHG
NT seq 5751 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagcatgccctctggcatgggacccaacacggtgtccaatgcggggcccggc
atgggacagaacatggggcccaacatgggacccggcatggctcctaacatgggggctatg
ggttccgccgcaccccaacagcacattatctcggtgtcgacgagcgggggcggcatggcc
cccctggggggaccgccgcagtccccgatgcctcccccctcgtccccaatggggggcccc
tccccctcgccacgcatgcagcagccaccgacgtctcccctgccggtgccctcgcccctg
ctgtcgcagatgtccccgcagctgccctcgccacgcaccccgaggccccccaacacacac
cccttgtcccagttgcaacagcagcatcaaatgcagcagatgctgatcaagagggaggat
gggagtctgggggtcccccatggcctgcgcatgtccccgcacatggccccgaggcccttc
cagcaacacgagcagcagcagcacatcctgctccacccgaggttccctgggcagccccag
atgccacgctacctcatccgacaagggagcgacccggccagccagcaccccccgggccac
ccgtacctgcagcgcaccggaggggtacaccccatgatgcggcccccgcccccttacccg
gaccacctgcgcaagccgccgccctccccagccatgtcccccggccacgggccagacggg
ggggacaaccccgacccctcgcgcacgcccccgtccctgtcccgccccaactcgcagccc
gccctgccctccccggacccccggtcatcccccatggagcgccacttctctcccgggacc
ccctccagctcctccagcctgccccagcgctccccggctgtgcccacgtctctggcggac
gacgccaggggtgacgtgggcgagcgctccgtcgagagcctgtcggacctcctctcccgg
gtttccaagaccccctccgagtccccgagcccacaaagccgcggggaggaagggcggccc
tccaccggggagccttccccaggcaggggctgcggctcgcaggacaacagtggccagacg
ccgccgctttccaagcaggaaagcatcctgcagtacctcagggccgggtcggtcggcagc
cccgccagcaactccaactcgtcgcgcgggagcgtggacagcttcgctggcgtggcgggc
ggccaggcaatgtgctctgtggcagagtcgcgcgccacagagagcccccactatgtgccc
gcatccgtctaccagagcgctggggcctctcccgtcggcagcccgtcgccctcggccttt
gcggcacagagccagtcaatgtccacaggcgacgcgttcgcctcggacgggagcgacagc
tcgtcccccatgcaagtgcggactcaaatggtgcgcgtgagccagggcatgatggggctc
cccacgacgacctacgtgcagcaaatccgccagcaacagcagcagatgatgctgcagcag
agccagtacgtcccccagcagggtatggccatccgacgacctcccgcccagagccccagg
ggctccgtgccctttggggactcccagtttgtgcgtgcccagatgttcagggcagccgcg
ccggcgaacgccaacgtggcgcgcaacttcgtcgtgcggcccggcggcaacaacccccct
ggctcgggcggcggcctgcgggggggtcgcccccacacggtcgggggaggccggggggcc
gtccccgcgagcccgcccaaagcctcctcctcctcaggggacgagggggagggggcctcc
tcgaccccctcgcttctgcaccgggcgggggaagggggcagcagttcctttgggggcagc
accttccacgtggggccctcatccacgctggtctccttcgagacggagcagatgcagacg
agcgtgttcgtgtccctcgactaccccgcggccaccatcaccagccacgacgggctgcgt
ctcgacgaagaggatggcgacgcctcccgcgtggcccttgttatggttggggacggggac
ggggggcagcctgacgccgttgagcacggggagcccctggacgtggctgttgtggtggag
actgtgggtgccctctcggactgcgaccccggggacgacggctcgagccccggcgggtcg
gacggggctgatggcatggcccctcccggctgcggcgagctgcaccagcgtggcacgccc
gcgggggaccacaactactccaaccctccgccggaaggggccgacgaggacgtggccaag
aagctggtcggccggacccagttcttcgacggagtggacgtgggcatcaagctggaggac
tccgtcctggggtgtatttccgaagagaaaccgaacatcgagaagctgctaagcgagcgg
atcacacctccacagcgtgcctcaaagactccctctccgccggcggcccctgttgccacg
agcgccatgtccttccctgcgtcggtgacccacacgctgaacttcaccctgaggcagacg
gggatgccccagacagtgcgcctctccaacgatgagggccagctcgtcgttcttcccggc
aaggccatggcaactcagctgtccctgtcgccgcctgccgttgcctgcgagccccccgtg
accccgaagatggaaccggcctccgccctgacgcctcccgcgatgctgcgcgtgcacgcc
gcgcttgcggctcccccatcctcagcgtgcgggtcccacgcagccggcttgcgctggtgc
cgaaccccgccagaggtgaaggaggagggcaccccctccgtgccgcccacgccgccaccc
gccctgccaccggtggtggtgaagcaggaggcccgctcgaccccttccccgtgtctggcc
gcctgccacaagcaggagtccgaggatgtggaggaagggagcgtcgaggccgccgacacg
ggcgccagccgcctgaccgatggagcggcagtgccccggaccgagagtaactcttgcgat
gatggtgtcccccctgaacagaggctcgctctccccgtcacccctcccgtcgccacgccg
accctcccggtcgccttgatggccaaagacaccgcggcggcccttgcagctgtgaaagtg
gaacccaccgtggcagcagtggccgtttcagaagcccaggcaggtgcggcggaggaggcg
tccgccccgaaggcttgcgagggctctgtcgaagggcctgacgggcccacgggtggcaag
cagaacgtgctcctcaagcagctcctacagaactgtccctcagccgagacgccccacgtc
gcagacctgcccgagggtgctcccacagtccaaactgcctgcagtggcaaatcggagaac
ggcacgggggagctctcacagacggcgtcgttgtcgccctccctgccttcgagtccctcg
agccagccggccaccacgactgcagaaaccgccgtgacaacgacggcagtgccggcttcg
gctccggtaaacgaacttgacgtgccggccaccacggtcggcaccccggagtcgcagaca
gtcgtcggcgtggccggaacccaggctggggccacgaccactcccgacaccgacaagccc
gaagagtcgaaaggctccagggggggccccgaggaggactacgagctgttcctcgaggcc
ctgctggggcgcctcagggccctgcccccagtgcgcatcctcgagcccctcatccggcca
aacttcaacgtgggcgtcgtcttcggccggggagacctcaacctcagggaatcgagcctg
aagggcagctacggccgggcgttcctgccgggccagccggacgcgtattcggtgtgcccc
ttcggcgatcggccccctccccccgtggccccctcctccgctgccaccccctctcccaca
cccctcaggggcttctacaaccaggagttctccgtgcatgccagagtaacttccggtggt
gcggactccaataggtgccgtgaggcggacagtcccgacacaatcgtgggcgcctcgtcc
ccggagtgcgccatgttcgaggcccccttccggttccgtggcctgcagctcatcgacgag
gacagcaacgactctgcgagatccctcccctcgcccacggtgcccattgtcgcgcccatt
cctgtaaaagacgagaagaccaaggagattgctttttcgggagaccgcttgccttgcttt
tcccggctcgcggggtgcgggggcctcctccggcaaaccttgcgggactcgcccaatgtg
tcggtgaccttgaccctgagctcggaggctgcgacggacatccggggcgtgctctgcttc
ctggtcaagcttgctgcagatcgagcccccgtcgagctacgacatcgtggagcgcacgag
cacccctccccagccagaagctggggctctacaagcacagaagctacggtggtgtgccac
gccggcagaggcgaccacccgtgccgagaggcgccggacagctcccgcgaccggctggcg
agaggagtggcggcggccagggaggtcgtgcgggcgctgggtgaagacgacgaggcctct
ccggcgcccaaggaagaagagggggaggaggaggaagaggaggaggagggaaggctgctg
ggcgacctcgaggggagtcccgccagcgaggagctccggaagagggcgcccaagcactcc
ctggcactccaccgggagcagctgttagatgctcaagatatatgtgtaaagccggataag
ccagtcgaagacacgaggaggtgcattctgtgccacgtcgttggagatggagaaacaaat
gggccggccaggctgctgaacctggacgtggacatgtgggtgcacctgaactgcgccctg
tggtcccaggaggtgtacgagacggtcaacggggccctgatgaacgtggcgtcggcctgc
cgccgcgccgtgctgctcacctgctgctgctgccaacgcacgggggcttcgctgcgctgc
ttccggctgcgctgcaccgccgcctaccacttcccctgcgccgccaaggatggctgctcc
ttcttcaaggacaagaccatcctgtgtccccagcacacgcctcgtgtcccgaacctcgag
aatgtcctcgagtccgtggccgtcttccggagggtatacataaaccgtgacgagcacaaa
caagtcgccagcatgattcataagggggagcagaatcttcttcgagtgggcagcctcatt
ttcctcagtgttgggcagctgctgccacaccagctgcagaatttccacacaccaaactgc
atctaccctgtgggcttcaaggtggtgcgcatctactggagcatgcacaagctgggtgcc
cgcagccgctacacgtgcagcatccacgacgtggacggccagccccagttccaagtgcga
gtctccagtggcggacacgagaagatcctgtcgcaccgcactcccaagggggtgtggcaa
aaggtgctgcagcccatcgagaacttccgccgggaggcccaggccatcaaggtcttctcc
aacttcatcacaggggaagacctgtttgggctgacagagcccgccatcgtgaggatcacc
gagtcgcttcctggtgtggacaccctgaatgactacaacttccggtacggacggtcgcca
ctgctggagcttccactggccatcaaccccacggggtgcgcccgttccgagcccaagctg
cgcacccatttcaagagtacggaagctgacacggcgggggtgcatggctga

DBGET integrated database retrieval system