KEGG   Ichthyobacterium seriolicida: JBKA6_0319Help
Entry
JBKA6_0319        CDS       T05228                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ise  Ichthyobacterium seriolicida
Pathway
ise00010  Glycolysis / Gluconeogenesis
ise00020  Citrate cycle (TCA cycle)
ise00620  Pyruvate metabolism
ise01100  Metabolic pathways
ise01110  Biosynthesis of secondary metabolites
ise01120  Microbial metabolism in diverse environments
ise01130  Biosynthesis of antibiotics
ise01200  Carbon metabolism
Module
ise_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ise00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JBKA6_0319
   00020 Citrate cycle (TCA cycle)
    JBKA6_0319
   00620 Pyruvate metabolism
    JBKA6_0319
Enzymes [BR:ise01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     JBKA6_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118
Motif
Other DBs
NCBI-ProteinID: BAV94332
UniProt: A0A1J1E2S7
LinkDB All DBs
Position
complement(425395..426618)
Genome map
AA seq 407 aa AA seqDB search
MTEGVVSRWYKKIGDKVSEGDILADIETDKATMEFESFQEGTLLYIGIKEGESAKVDSLL
AILGEEGTDISSIVEKYKTESTDSNKTDKSDSDSVKTESTDEKKSAEKNEEKSAVDVRGI
NTRDDGRLRISPIAKKMAMDKGMDITKITGTGDFGRIIKRDIDNFKGESAIDTGSASHNQ
EAFTETDISPMRKVIANRLSESKFTAPHYYLTVEIDMGNAITARKSINESVETKVSFNDI
IVKAASMALAKHPEVNTNMVGTDKIRYNKHINIGVAIAIDGGLLVPVVRYANTKSISQIS
HEIKDLSKRARDKKLLPADWEGSTFTISNLGMLGIESFTSIINQPDSAIMSVGAIIQKPV
VKNGQVTVGNTMKITLACDHRTIDGMVGALFLQTFKKMLENPINMLA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgactgagggtgttgtgtctaggtggtataaaaaaataggggataaagtatctgaagga
gatatactagccgatatagagacagacaaggctactatggagttcgaatctttccaagag
ggaacccttctatatataggtattaaagaaggtgaatctgcgaaagtagatagtctattg
gctattcttggagaagaaggaaccgatatttcttctatagtagagaaatataaaactgag
tctaccgacagtaataagactgataaatctgattcagattcagtcaaaacagaatctaca
gatgagaagaaaagtgcagaaaaaaatgaagaaaaaagtgctgtagatgtcagaggtatt
aatactagagatgatggtagattaagaatatctcctatagctaaaaagatggctatggac
aaggggatggatataactaagataactggaacaggagattttggcagaattatcaaaaga
gatatcgataatttcaagggagaaagtgctattgatacaggttcagcctctcataatcaa
gaggcttttactgagacagatatttctccaatgcgtaaagtcatagctaataggttatca
gaatctaaatttacagctcctcattattatctcacagtagagatagatatgggtaatgct
attacagctagaaaatctataaacgagtcagttgaaactaaggtttcctttaacgatata
attgtcaaggcagcatctatggccttggccaaacatccagaggttaataccaatatggta
gggacagacaaaatacgatataataaacatatcaatataggtgtagcaatagcaatagat
ggagggctgttagttccagttgttagatacgccaatactaaatctatatctcagatatct
catgagataaaagatctctctaagagggctagggataaaaaattattgcctgctgattgg
gaaggtagcactttcaccatatctaatttaggaatgttgggaatagagagttttacttct
attataaatcagcctgattcagcaattatgtctgtgggggccataatacaaaagccagta
gtgaaaaatggacaggtaactgtaggaaatacaatgaaaataactttagcttgtgaccat
aggactattgacggaatggttggagctctgtttttacagacatttaaaaagatgttagaa
aaccctataaacatgttagcttag

DBGET integrated database retrieval system