KEGG   Isoptericola variabilis: Isova_0467Help
Entry
Isova_0467        CDS       T01520                                 

Definition
(GenBank) Maltose alpha-D-glucosyltransferase
Organism
iva  Isoptericola variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AEG43264
UniProt: F6FU68
LinkDB All DBs
Position
complement(497279..498982)
Genome map
AA seq 567 aa AA seqDB search
MRIRDTGDLWWKNAVVYCLDVETFMDWNDDGIGDFPGLVQRIDHLADLGATCLWLMPFYA
TADLDDGYDVTDFLAVDERLGDLGDVVELVRTARDRGIRVIVDLVVNHTSDQHPWFRSAR
RSKDSPFRDFYVWRADEPPPTKDQVVFPDKEDAIWTFEEKTGEWYRHRFYHHQPDLNTAN
PKVRDALAKTIGFWLELGISGFRVDAVPFALADAASTPDDEIDDPHEFLRILRAFVGRRA
GDAILMGEVNLPYLEQAKYFGNSDPTDGGDGGTDVTELTMQFDFNAMQAMYLSLAREDVG
PLAAALRSRPPIPHDAQWATFVRNHDELTLDKLSEEERQEVFAAFGPEEDMQLYGRGLRR
RLPPMLGGDPRRVRMVYSLLFSLPGTPVLYYGEEIGMGENLAAEGRLAVRTPMQWTPERN
GGFSRAAERSLAGPLPTDGYAPEHVNVADQRRNPDSLLAFVRTLAHRYRECPELGWGDWE
ILDQPHAAVLALRSTWQDASMVTLHNLSPNPAVVPLELGELEEGSRLVDLLTDDDCEPEP
DGSAEVRLDGYGYRWLRVTQPSSRRLL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgaggatccgcgacaccggcgacctgtggtggaagaacgccgtcgtctactgcctcgac
gtcgagacgttcatggactggaacgacgacggcatcggcgacttcccgggcctcgtccag
cgcatcgaccacctggccgacctcggtgcgacgtgcctgtggctcatgccgttctacgcc
acggccgacctcgacgacgggtacgacgtcaccgacttcctcgcggtcgacgagcgcctc
ggcgacctgggcgacgtcgtcgagctcgtccgcacagcgcgcgaccgcgggatccgcgtc
atcgtcgacctcgtcgtcaaccacacctccgaccagcacccgtggttcaggtccgcgcgc
cggtcgaaggactcgccgttccgggacttctacgtctggcgcgccgacgagccgccgccc
acgaaggaccaggtcgtcttccccgacaaggaggacgccatctggaccttcgaggagaag
accggcgagtggtaccggcaccgcttctaccaccaccagcccgacctcaacacggccaac
ccgaaggtgcgcgacgcgctcgccaagaccatcggcttctggctcgagctcggcatctcc
gggttccgggtcgacgcggtgccgttcgccctcgccgacgccgcctcgacgccggacgac
gagatcgacgacccgcacgagttcctgcggatcctgcgcgccttcgtcgggcgacgcgcg
ggcgacgcgatcctcatgggcgaggtcaacctgccctacctcgagcaggcgaagtacttc
ggcaactccgacccgaccgacgggggcgacggcgggaccgacgtcaccgagctcacgatg
cagttcgacttcaacgcgatgcaggcgatgtacctgtcgctcgcgcgcgaggacgtcggc
ccgctcgccgcggcgctgcggtcgcgcccgcccatcccgcacgacgcgcagtgggcgacg
ttcgtccgcaaccacgacgagctcacgctcgacaagctctccgaggaggagcgccaggag
gtcttcgcggcgttcgggcccgaggaggacatgcagctctacgggcgcggtctgcgccgc
cggctgccgccgatgctgggcggcgacccgcgccgcgtccgcatggtctactcgctgctc
ttctcgctgccggggaccccggtgctgtactacggcgaggagatcggcatgggcgagaac
ctcgccgccgagggcaggctcgcggtccgcacgcccatgcagtggacacccgagcgcaac
ggggggttctcgcgggccgccgagcggagtctcgccggccccctgccgaccgacgggtac
gcgcccgagcacgtcaacgtcgccgaccagcgccggaacccggactcgctgctggcgttc
gtccgcacgctcgcgcaccgctaccgcgagtgccccgagctcggctggggcgactgggag
atcctcgaccagccgcacgccgccgtgctcgcgctgcggagcacgtggcaggacgcgtcg
atggtcacgctccacaacctgtcgccgaaccccgccgtggtgccgctcgagctgggtgag
ctcgaggagggctcgcggctcgtcgacctcctgaccgacgacgactgcgaacccgagccc
gacggcagcgcggaggtccggctcgacgggtacggctaccgctggctgcgcgtcacgcag
ccgagctcacgccggctgctctga

DBGET integrated database retrieval system