KEGG   Isoptericola variabilis: Isova_0535Help
Entry
Isova_0535        CDS       T01520                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
iva  Isoptericola variabilis
Pathway
iva00564  Glycerophospholipid metabolism
iva01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:iva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Isova_0535
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Isova_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEG43330
UniProt: F6FUR9
LinkDB All DBs
Position
complement(576160..577905)
Genome map
AA seq 581 aa AA seqDB search
MASTRLTAESREQALAALDASREATGELDVLVVGGGVTGAGIALDAVTRGLSTAVVEAQD
WASGTSSRSSKLVHGGLRYLQMLDFHLVHEALTERDLLLKELAPHLVRPVPFLYPLEHRV
WERAYVGAGIALYDTLAAIAPGRRAMPIHRHLTRRAIARKFPDLAHDAAIGAVQYWDASV
DDARLVATLVRTAASYGAHAASRTQVVELTKSATGAVNGAVVVDLETGREITVRARHVVN
ATGVWTEDTEALAGDQGGLHVLASKGIHIVVPRERIKGQVGLILQTEKSVLFIIPWSRYW
IIGTTDTPWNLDPVHPVATATDIDYVLDHANAVLAHPLSRDDVIGTYAGLRPLLQPGTKE
GTSSAKVSREHTVASPAPGLTVIAGGKLTTYRVMAKDAIDFAIGSRASALPSITHRIPLL
GAVGLQAVQRQARAWAQRYGWTPAMVDHLLHRYGSNLREIVELCEADASLARPLEHAPAY
LRAEVHYGVSHEGALHLEDLLLHRTRLIYEVPDSGLAALPEIADVAGPLLGWDDAARERE
IAAYTSIVEAERAAALESDDAAAEAARRRAADVAAMRPLRT
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccacacgactcacggccgagtcgcgcgagcaggcgctggcggcgctcgacgcg
tcgcgcgaggcgaccggcgagctcgacgtgctcgtcgtgggtggcggcgtgaccggcgcg
gggatcgcgctcgacgccgtgacccgcgggctgtccacggccgtcgtcgaggcgcaggac
tgggcgtcgggcacctcgagccgcagcagcaagctggtgcacggcggcctgcggtacctg
cagatgctcgacttccacctcgtgcacgaggcgctcaccgagcgcgacctgctgctcaag
gagctcgcgccgcacctcgtgcgcccggtccccttcctctacccgctcgagcaccgcgtg
tgggagcgcgcctacgtcggcgccggcatcgcgctgtacgacacgctggcggcgatcgcg
ccgggacgccgggccatgccgatccaccgccacctcacgcggcgcgcgatcgcccgcaag
ttccccgacctcgcgcacgacgccgcgatcggcgccgtgcagtactgggacgcgtcggtc
gacgacgcgcgcctcgtcgcgacgctcgtgcgcaccgccgcgagctacggcgcgcacgcg
gcgtcgcgcacccaggtggtcgagctgaccaagagcgccaccggcgcggtcaacggcgcc
gtcgtcgtcgacctcgagaccggccgcgagatcacggtccgcgcccgccacgtcgtcaac
gccaccggtgtgtggaccgaggacaccgaggcgctcgccggcgaccagggcggcctgcac
gtgctggcgtccaagggcatccacatcgtcgtgccgcgcgagcggatcaagggccaggtc
ggcctgatcctgcagaccgagaagtccgtgctgttcatcatcccgtggtcgcggtactgg
atcatcggcacgaccgacacgccctggaacctcgaccccgtgcaccccgtcgcgaccgcg
acggacatcgactacgtgctcgaccacgccaacgcggtgctcgcgcacccgctgtcgcgc
gacgacgtcatcggcacctacgcgggcctgcgcccgctgctgcagcccggcaccaaggag
ggcacctcctccgccaaggtgtcgcgcgagcacaccgtcgcctcccccgcgcccggcctg
accgtcatcgcgggcggcaagctcacgacgtaccgggtcatggccaaggacgcgatcgac
ttcgcgatcggctcccgggcgtcggcgctgccgtccatcacgcaccgcatcccgctgctc
ggcgcggtcggcctgcaggccgtgcagcgccaggcgcgcgcgtgggcgcagcgttacggc
tggacgcccgccatggtcgaccacctgctgcaccggtacgggtccaacctgcgcgagatc
gtcgagctgtgcgaggcagacgcgtcgctcgcgcgcccgctcgagcacgcgcccgcctac
ctgcgcgccgaggtccactacggcgtgagccacgagggcgcgctgcacctcgaggacctc
ctgctgcaccgcacgcgcctgatctacgaggtgccggacagcgggctcgccgcgctgccg
gagatcgccgacgtcgccggaccgctgctcggctgggacgacgccgcgcgcgagcgcgag
atcgcggcctacacctcgatcgtcgaggccgagcgcgccgccgcgctcgagagcgacgac
gccgcggccgaggccgcccgacgacgggccgcggacgtcgcggccatgcgcccgctccgc
acctga

DBGET integrated database retrieval system