KEGG   Isoptericola variabilis: Isova_1647Help
Entry
Isova_1647        CDS       T01520                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
iva  Isoptericola variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEG44399
UniProt: F6FVH2
LinkDB All DBs
Position
complement(1779743..1780900)
Genome map
AA seq 385 aa AA seqDB search
MSLPLQPPILPMLAKSVPEVPEQPDGDAQWVYEPKWDGFRAIVYRDGDDVRIDSRNARPM
QRYFPEVVAAVLDALPERCVVDGEIVVARPDPGPGPARLDFDALSQRIHPAESRVRLLAE
QTPASLVVFDVLALGDDDLSRRPLAERLDALDGLGLSGPHVFATPRTHDTAVAREWFEAF
EGAGLDGVVAKRLDGRYEPNKRTLLKIKHARTADVVLAGYRLHKTSTPAEPLIGSLLLGL
YDGDEDGDPGQLQFVGVAASFPAARRAALHAELAPLVVEPGTPEHEAHPWADWQDPAVAD
GTAGERRPGAQSRWSAGKDLSFTPLRVERVLEVGYDHMEGTRFRHTAQFKRWRPDRDPTS
CTYAQLEEPVRYDLGSLLPGAPGTA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgccgctgcagccgccgatcctgccgatgctcgccaagtccgtgcccgaggtg
ccggagcagcccgacggcgacgcgcagtgggtctacgagcccaagtgggacgggttccgc
gcgatcgtgtaccgcgacggggacgacgtccgcatcgactcgcgcaacgcccgccccatg
cagcgctacttccccgaggtggtcgcggccgtgctcgacgcgctgcccgagcggtgcgtc
gtcgacggcgagatcgtggtcgcgcggcccgacccgggccccggaccggcgcggctcgac
ttcgacgcgctctcgcagcgcatccacccggccgagtcccgcgtgcggctgctcgccgag
cagacgcccgcgagcctcgtggtgttcgacgtgctcgcgctcggcgacgacgacctgtcc
cgccgcccgctcgcggagcgcctcgacgccctcgacgggctcgggctgtccgggccgcac
gtcttcgcgacgccgcgcacgcacgacaccgcggtcgctcgcgagtggttcgaggcgttc
gagggcgccggcctcgacggcgtcgtcgccaagcggctcgacgggcgctacgagcccaac
aagcgcaccctgctcaagatcaagcacgcccgcacggcggacgtcgtgctcgccgggtac
cggctgcacaagacgtcgacgcccgccgagcccctcatcggctcgctgctgctgggcctc
tacgacggggacgaggacggcgaccccgggcagctgcagttcgtcggagtcgcggcgtcg
ttcccggccgcccgccgggccgcgctgcacgccgagctggccccgctcgtggtcgagccc
ggcacgcccgagcacgaggcgcacccgtgggccgactggcaggacccggccgtcgccgac
ggcaccgcgggggagcggcgccccggcgcccagtcccgctggagcgcgggcaaggacctg
tcgttcacgcccctgcgcgtcgagcgcgtgctcgaggtcggttacgaccacatggagggc
acccggttccgccacaccgcgcagttcaagcgctggcgccccgaccgcgacccgacgtcg
tgcacgtacgcccagctcgaggagcccgtgcgctacgacctcggttcgctgctgcccggc
gcgccggggacggcctga

DBGET integrated database retrieval system