KEGG   Isoptericola variabilis: Isova_1685Help
Entry
Isova_1685        CDS       T01520                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
iva  Isoptericola variabilis
Pathway
iva00020  Citrate cycle (TCA cycle)
iva00190  Oxidative phosphorylation
iva00650  Butanoate metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01120  Microbial metabolism in diverse environments
iva01130  Biosynthesis of antibiotics
iva01200  Carbon metabolism
Module
iva_M00009  Citrate cycle (TCA cycle, Krebs cycle)
iva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
iva_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:iva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isova_1685
   00650 Butanoate metabolism
    Isova_1685
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Isova_1685
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Isova_1685
    1.3.5.4  fumarate reductase (quinol)
     Isova_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7 Fer4_9 DUF1126
Motif
Other DBs
NCBI-ProteinID: AEG44437
UniProt: F6FVL0
LinkDB All DBs
Position
complement(1818660..1819409)
Genome map
AA seq 249 aa AA seqDB search
MSYTGRFRVWRGSSVGGELVDFDVEVNEGEVVLDVIHRLQATQAPDLAVRWNCKAGKCGS
CSAEINGRPRLLCMTRMSLFAPDDVVTVTPMRTFPVIRDLVTDVSYNYEKAREILSFTPP
IDLAPGEYRMSQADVQRSQEFRKCIECFLCQDTCHVVRDHEENKRAFAGPRFLMRVAELE
MHPLDVSDRVSAAQDEHGLGRCNITKCCTEVCPEGIKITDNALIPMKERVAGQRYDPLVW
LGRTIRRRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagctacacggggcggttccgcgtgtggcgcggcagctcggtcggcggcgagctcgtc
gacttcgacgtcgaggtcaacgagggcgaggtcgtgctcgacgtcatccaccggctccag
gccacccaggcgcccgacctggcggtgcggtggaactgcaaggcgggcaagtgcgggtcg
tgctcggcggagatcaacggccgcccacggctgctgtgcatgacccggatgtcgctgttc
gcccccgacgacgtggtgaccgtgacgcccatgcggacgttcccggtgatccgcgacctc
gtgaccgacgtgtcgtacaactacgagaaggcccgcgagatcctgtcgttcacgcccccg
atcgacctcgcgccgggcgagtaccggatgagccaggccgacgtccagcggtcgcaggag
ttccgcaagtgcatcgagtgcttcctgtgccaggacacgtgccacgtcgtgcgcgaccac
gaggagaacaagagggcgttcgccggcccgcgcttcctcatgcgggtcgccgagctcgag
atgcacccgctcgacgtctcggaccgcgtctccgcggcgcaggacgagcacggcctgggc
cggtgcaacatcaccaagtgctgcaccgaggtgtgccccgagggcatcaagatcaccgac
aacgcgctcatccccatgaaggagcgcgtggccggtcagcgctacgaccccttggtctgg
ctcggccggacgatccgccgccgacgctga

DBGET integrated database retrieval system