KEGG   Isoptericola variabilis: Isova_1686Help
Entry
Isova_1686        CDS       T01520                                 

Definition
(GenBank) Succinate dehydrogenase (ubiquinone)
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
iva  Isoptericola variabilis
Pathway
iva00020  Citrate cycle (TCA cycle)
iva00190  Oxidative phosphorylation
iva00650  Butanoate metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01120  Microbial metabolism in diverse environments
iva01130  Biosynthesis of antibiotics
iva01200  Carbon metabolism
Module
iva_M00009  Citrate cycle (TCA cycle, Krebs cycle)
iva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
iva_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:iva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isova_1686
   00650 Butanoate metabolism
    Isova_1686
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Isova_1686
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Isova_1686
    1.3.5.4  fumarate reductase (quinol)
     Isova_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 HI0933_like GIDA FAD_binding_3 FAD_oxidored Pyr_redox_3 Sirohm_synth_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEG44438
UniProt: F6FVL1
LinkDB All DBs
Position
complement(1819406..1821340)
Genome map
AA seq 644 aa AA seqDB search
MTTIERHEYDVLVVGAGGAGLRAAIEARERGLRTGIVCKSLFGKAHTVMAEGGCAAAMGN
VAEKDSWQVHFRDTMRGGKFLNSWRMAELHAKEAPDRVWELEAWGALFDRTPDGRISQRN
FGGHTYPRLAHVGDRTGLELIRTLQQRVVALQRADYFATGDYESRLRVFAECTVTELLTD
DDGAIAGAFGYWRETGRFVEFSAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGAG
LVDMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLRNSDGDRFMFRYVPDVFKGQYAQT
EDEADRWYTDQDNNRRTPDLLPRDEVARAINTEVKEGRGSPHGGVFLDIASRMPAEEIKR
RLPSMYHQFKELADVDITAEPMEVGPTCHYVMGGIDVDPDTGQSSVPGLFAAGECAGGMH
GSNRLGGNSLSDLLVFGRRAGLGAADYVTGLARRPSRRDRDVEAAARTALAPFDPPSRGA
RAENPYTLHAELQGVMNDLVGIIRTEDEMTEALERLGELRARLRHVVVEGHRQYNPGWHL
ALDLRNMLMVSEAVASSALMRTESRGGHTRDDHPMLDPEWRHRVLVTRCVPGEAADGLAV
PRVEVEVAERAPMREDLLALFDLTELEKYYTPAELTAHPEGGAA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgatcgaacggcacgagtacgacgtcctcgtcgtcggcgcgggcggggccggg
ctgcgcgcggcgatcgaggcgcgcgagcgcggcctgcgcaccgggatcgtctgcaagtcg
ctgttcggcaaggcgcacaccgtgatggccgagggcggctgcgccgcggcgatgggcaac
gtcgccgagaaggactcgtggcaggtgcatttccgcgacacgatgcgcggcgggaagttc
ctcaacagctggcggatggccgagctgcacgcgaaggaggcgcccgaccgcgtctgggag
ctggaggcctggggggcgctcttcgaccgcacgcccgacggccggatcagccagcgcaac
ttcggcggccacacctacccgcggctcgcgcacgtcggcgaccggaccggcctcgagctc
atccgcacgctccagcagcgcgtcgtggcgctgcagcgggccgactacttcgcgaccggc
gactacgagtcgcgcctgcgcgtgttcgccgagtgcacggtcaccgagctgctgaccgac
gacgacggcgcgatcgccggcgcgttcgggtactggcgggagaccggccggttcgtggag
ttctccgcgcccgcggtcgtgctcgccaccggcgggatcggcaagtcgttcaaggtgacg
tcgaactcctgggagtacacgggcgacggccacgcgctcgccctgcgcgccggcgccggc
ctcgtcgacatggagttcgtccagttccacccgacgggcatggtgtggccgcccagcgtc
aagggcatcctcgtgacggagggcgtgcgcggcgacggcggcgtgctgcgcaactccgac
ggggaccggttcatgttccggtacgtgccggacgtcttcaagggccagtacgcccagacg
gaggacgaggccgaccgctggtacaccgaccaggacaacaaccgtcgcacgcccgacctg
ctgccccgcgacgaggtggcgcgggcgatcaacacggaggtcaaggaagggcgcggctcg
ccgcacgggggagtgttcctcgacatcgcgagccgcatgccggccgaggagatcaagcgg
cgcctgccgtcgatgtaccaccagttcaaggagctggccgacgtcgacatcacggccgag
cccatggaggtgggcccgacgtgccactacgtcatgggcgggatcgacgtcgacccggac
acggggcagtcgagcgtgccgggcctgttcgcggcgggggagtgcgcgggcggcatgcac
ggctcgaaccggctcgggggcaactcgctgtcggacctgctcgtgttcggccgacgcgcg
ggcctcggcgcggccgactacgtcaccgggctcgccaggcgcccgtcgcggcgcgaccgc
gacgtcgaggcggccgcgcgcacggcgctcgcgcccttcgacccgccctcgcgcggcgcc
cgggccgagaacccgtacacgctgcacgccgagctgcagggcgtcatgaacgacctcgtg
ggcatcatccgcacggaggacgagatgaccgaggcgctcgagcggctcggcgagctgcgg
gcgcgcctgcgccacgtcgtcgtcgagggccaccggcagtacaaccccggctggcacctg
gcgctggacctgcggaacatgctcatggtgagcgaggcggtcgcgtcctcggcgctgatg
cgcaccgagagccgcggcgggcacacccgcgacgaccacccgatgctcgacccggagtgg
cgccaccgggtgctcgtgacccgctgcgtccccggcgaggcggccgacggtctcgcggtg
ccgcgtgtcgaggtcgaggtcgcggagcgcgcccccatgcgcgaggacctgctcgcgctg
ttcgacctcaccgagctcgagaagtactacacccccgccgagctgacggcccatcccgaa
ggaggcgccgcatga

DBGET integrated database retrieval system