KEGG   Isoptericola variabilis: Isova_1812Help
Entry
Isova_1812        CDS       T01520                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
iva  Isoptericola variabilis
Brite
KEGG Orthology (KO) [BR:iva00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:iva01001]
    Isova_1812
Enzymes [BR:iva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Isova_1812
Protein kinases [BR:iva01001]
 Serine/threonine kinases: Other
  Bacterial family
   Isova_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like ABC1 Kdo
Motif
Other DBs
NCBI-ProteinID: AEG44558
UniProt: F6FWI4
LinkDB All DBs
Position
1958481..1960499
Genome map
AA seq 672 aa AA seqDB search
MATVTTDPLLGRLVDGRYEIVARIARGGMATVYRATDRRLDREVALKIMHPHLADGVEGA
SFVSRFRREARAAARLTHPGVVAVYDQGLDGETSYLTMEYVPGTNLRRELRSSGTLTLGR
TLDVLAQVLAALAAAHRKGLVHRDVKPENVLITADGAHVKVADFGLARAVTEVTSTATGT
ILGTVAYLAPEVITTGGCDARTDVYAVGILAYEMLTGALPYAGETPIQVAFHHVHDDVPA
PSGEVPWLPAEVDELVAAFTARDPGRRPADAAAALDSLERVRAGLDPDLLDRRADLPATA
GAVDADSPAGDAGDDSPEADGIDSDRLDAIPAAFFQEVSAPDERTEMLVEESTTRVPGRP
AADRTHSPAAPPRRRRRRRALAWTLTLLLLVAGGAAGTWWWFADGPGAWTRVPDGVVAVP
LEDARDVLAAAELGSTVTRSHHDEVPAGTVIESRPAPGDPVRTDGQVHLVVSRGIRTIPV
PDGLVGATHQDATAALRAAGFEVGEPSPQHHDTVPEGEVMAVSVPEGSVQPHTTVVTLTV
SDGPAPVTVPQQVGKPKDDAVADLESVGLKVELAEPEHSLDVAEGHVLRQDPEAGAQAHR
TDTVTLTLSAGPPIVAVPDVVGMRTGAARAALEEAGFEVEENKYLGGLLDTVRFQDTTGE
APQGSTVTLTIW
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtggccaccgtgacgaccgacccgctcctcggccgcctggtcgacgggcggtacgagatc
gtcgcgcgcatcgcgcgcggcgggatggccacggtctaccgggcgaccgaccggcgtctc
gaccgcgaggtcgcgctcaagatcatgcacccgcacctcgccgacggcgtcgagggcgcc
agcttcgtctcgcgcttccgccgtgaggcccgcgccgccgcccggctgacgcatcccggc
gtcgtcgcggtctacgaccagggcctcgacggcgagacgagctacctcacgatggagtac
gtgccgggcacgaacctgcggcgcgagctgcgctcgtcgggcaccctcacgctcggccgc
acgctcgacgtgctcgcgcaggtcctggcggcgctcgcggcggcgcaccgcaagggactc
gtgcaccgggacgtcaagcccgagaacgtgctcatcaccgccgacggcgcccacgtcaag
gtcgccgacttcgggctcgcacgggcggtcaccgaggtgacgtcgaccgcgaccggcacg
atcctcggcacggtcgcgtacctcgcgcccgaggtcatcacgacgggcggctgcgacgcc
cggaccgacgtctacgcggtcggcatcctcgcctacgagatgctcacgggcgcgctcccc
tacgcgggcgagacgccgatccaggtcgcgttccaccacgtgcacgacgacgtccccgcc
ccctcgggcgaggtcccctggctgcccgccgaggtcgacgagctcgtcgccgccttcacc
gcacgtgaccccgggcggcggccggccgacgccgccgcggcgctcgactcgctcgagcgg
gtgcgggcaggcctcgaccccgacctcctcgaccgccgcgcggacctgcccgcgaccgcg
ggcgccgtcgacgcggacagcccggccggcgacgcgggcgacgactcccccgaggccgac
ggcatcgactccgaccggctcgacgcgatccccgccgcgttcttccaggaggtctcggcg
cccgacgagcgcaccgagatgctcgtcgaggagtcgacgacgcgcgtccccggccgtccg
gcggccgaccgcacgcactcccccgcggcgcctccccgccgccggcgccggcgccgggcg
ctcgcctggaccttgacgctgctcctgctcgtcgcgggaggcgccgcggggacgtggtgg
tggttcgccgacggccccggcgcgtggacccgcgtgcccgacggcgtggtcgccgtcccg
ctcgaggacgcgcgcgacgtgctggccgccgcagagctcggctcgacggtcacgcggtcg
caccacgacgaggtgcccgcggggaccgtcatcgagtcccggcccgcgccgggcgacccg
gtccggaccgacgggcaggtgcacctcgtcgtctcgcgcggcatccgcacgatccccgtg
ccggacggcctcgtgggcgcgacgcaccaggacgcgaccgccgcgctgcgcgccgcgggg
ttcgaggtgggcgagccgagcccgcagcaccacgacaccgtccccgagggcgaggtcatg
gccgtctcggtccccgagggctccgtccagccgcacacgaccgtcgtcacgctcaccgtg
tccgacgggccggcgcccgtgaccgtgccccagcaggtcggcaagccgaaggacgacgcc
gtcgcggacctcgagagcgtcgggctgaaggtcgagctcgccgagccggagcactcgctc
gacgtcgccgagggccacgtgctgcgccaggacccggaggcgggcgcccaggcgcaccgc
accgacacggtgacgctgacgctgtccgcgggccccccgatcgtggccgtgcccgacgtc
gtcggcatgcgcacgggcgccgcccgtgcggcgctcgaggaggccgggttcgaggtcgag
gagaacaagtacctcggagggctgctcgacacggtgcgcttccaggacacgaccggcgag
gcgccccagggctcgaccgtgacgctgacgatctggtga

DBGET integrated database retrieval system