KEGG   Izhakiella sp. KSNA2: FEM41_08075Help
Entry
FEM41_08075       CDS       T05975                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
izh  Izhakiella sp. KSNA2
Brite
KEGG Orthology (KO) [BR:izh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FEM41_08075
Enzymes [BR:izh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     FEM41_08075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N
Motif
Other DBs
NCBI-ProteinID: QCT19614
UniProt: A0A4P8YJ10
LinkDB All DBs
Position
1756031..1757122
Genome map
AA seq 363 aa AA seqDB search
MTTLPTTIKRLVNHGPEDYRLETAALPQPGERELLVKIGACGICASDFHCYHGAPMFWGN
ETFPRYVKTPVVAGHEFYGEVVAAGPGAEEHFGVAPGDRAIAEQIVPCDKCRFCRSGQYW
MCEKHDIYGFQAQDADGGMADYMLFKPTSRVHKIPQSLSLEECALIEPFACSVHAVNRAS
IEFNDVVVLAGAGTLGLGMVQAIRLKTPKKLIVIDTMPHRLALAKQLGADEVLNALDEDV
VARVKAMTEGYGCDVYIEATGNPAAVNQGLQMVRKLGRFVEFSVFSRETSVDWSIIGDRK
ELDIRGAHLGPGCYETVIDLFHRGLMTAEGIVTHKFSLDNWQEAFKTFGTPEAVKVLLVP
EAE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacgactttacccacaaccattaagcggctggtgaatcatggccctgaagactatcga
ctggaaacggctgctctcccgcagccgggtgagcgcgagctgctggtgaagattggcgcc
tgcggcatctgcgcatcggacttccactgctatcacggcgcgccgatgttttggggtaac
gagacctttccccgctatgtgaaaacgccggtggtggcgggccatgagttttacggggaa
gtggtggcggcgggaccgggcgctgaagagcattttggtgtcgcgccaggagacagggcc
attgctgaacagattgttccctgcgacaagtgtcgcttctgccgctccgggcagtactgg
atgtgcgaaaagcacgatatctatggctttcaggctcaggatgccgatggcggcatggcg
gattacatgctgtttaagcccaccagtcgggttcataagattccccaaagcctgagtctg
gaagagtgcgcgctgatcgagccctttgcctgttcggtgcatgccgttaaccgcgccagc
attgaatttaatgatgtagtggtgctggcgggggcgggaaccctggggctgggaatggtg
caggccattcggctgaaaaccccgaaaaagctgatcgtcattgataccatgccccatcgc
ctggcgctggcaaaacagttgggtgccgacgaagtgctcaacgcgctggatgaagatgtg
gtcgcccgggtgaaggcgatgaccgaaggttacggctgcgatgtctatattgaggcgacc
ggtaatcctgccgccgtgaaccaggggctacagatggttcgtaagctggggcgctttgtg
gagttcagcgtattcagccgggaaacgtcggtagactggtccatcattggcgatcgcaag
gagctggatattcgcggcgcccaccttggcccgggctgctacgagacggttatcgatctg
tttcaccgcgggttgatgaccgccgaagggattgtcacccataaattcagtctggataac
tggcaggaagcgtttaagacctttgggacaccggaggcggtgaaggtgctgctggtgccg
gaggcggagtag

DBGET integrated database retrieval system