KEGG   Izhakiella sp. KSNA2: FEM41_13030Help
Entry
FEM41_13030       CDS       T05975                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
izh  Izhakiella sp. KSNA2
Brite
KEGG Orthology (KO) [BR:izh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FEM41_13030 (ahpF)
Enzymes [BR:izh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FEM41_13030 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 Thi4 K_oxygenase Glutaredoxin DAO AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: QCT20508
UniProt: A0A4P8YL19
LinkDB All DBs
Position
2862132..2863697
Genome map
AA seq 521 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELIATLDDSARSSEIRELLAEIAELSDKVSFTERNDLPV
RKPSFLITNPGSEQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAKELLEQIADLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGAYQNEISERNVMGVPAVFLNGKE
FGQGRMTLSEIVSKVDTGAEKRAAEALNQREAYDVLIVGSGPAGAAAAIYAARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSASRLVPAANED
GLHQIETASGATLKARSIIIATGAKWRNMNVPGEDEYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVDHVTLLEFAPEMKADQVLQDKVRSLSNVDIILNAQTTEVKGD
GTRVAGLEYQDRVSGATHSLELAGIFVQIGLLPNTNWLEGAVERNRMGEIIVDARGETSV
KGIFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactacgatgaaaacacagctcaaggcctatcttgagaaactgacaaagcct
gttgagttgattgccacgctggatgacagcgcacggtcatcggaaatcagggaacttctg
gcagaaatcgctgagctgtcagacaaagtctcttttacggagcgcaacgatctgccggtt
cgtaaaccctcttttctgattaccaaccccggatcggagcagggaccgcgttttgcgggt
tcgccgctcggccatgaatttacctcactggttctggcgctgctgtggaccggtgggcat
ccgtctaaagaggcgaaagagctgctggagcagatagccgacctcgacggtgattttgaa
tttgagacttattattcgctctcctgccacaactgcccggacgtggtccaggcgctgaac
ctgatggcggtgctcaacccgcgcatcaaacatacggccattgacggcggcgcttatcag
aatgagatcagcgagcgcaacgtgatgggcgtaccggcggtgttcctgaacggtaaagag
ttcggtcaggggcgtatgacgctttcggagatcgtcagcaaggtggataccggcgcggaa
aaacgcgcggcggaggccctgaaccagcgtgaggcctacgatgtgctgattgtcggctcc
ggccctgcgggtgccgctgcggcgatctatgcggcccgtaaagggattcgcaccggcttg
atgggcgagcgtttcggcggtcaggttctggataccgtggacatcgaaaactacatctcg
gtgccgaagaccgaaggtcagaagctggcgggcgccctgaaggcgcacgttgacgactac
gacgtggatgttatcgatacccagagcgcttcccgcctggtgcctgccgccaacgaagac
ggactgcaccagattgaaaccgcctcaggcgcgacgctgaaggcgcgcagcatcatcatc
gccactggggcgaaatggcgcaatatgaatgtgccgggcgaagatgagtaccgtacccgc
ggcgtcacctactgcccgcactgcgacggcccgctgtttaaaggcaaacgcgtggcggtg
atcggcggcggtaactccggcgtggaagcggcaatcgatctggcgggcgtggtggatcac
gtcaccctgctggagttcgcaccggaaatgaaagcggaccaggtcctgcaggataaagtt
cgcagcctgagcaatgtcgatattattctgaatgcccagaccaccgaggtgaagggcgac
ggcactcgcgtggcgggtcttgaatatcaggatcgcgtctccggtgccactcatagcctt
gaactggccgggatcttcgttcagattggcctgctgccgaataccaactggctggaaggc
gccgtagagcgcaaccgtatgggcgaaatcatcgttgatgcccgcggtgaaaccagcgtg
aaggggatcttcgctgcaggggactgcaccaccgtgccgtacaagcagatcattatcgcc
accggcgaaggggcgaaagcgtcactcagcgcctttgactacctgatccgcaccaaaacg
gcataa

DBGET integrated database retrieval system