KEGG   Izhakiella sp. KSNA2: FEM41_20940
Entry
FEM41_20940       CDS       T05975                                 

Definition
(GenBank) TIGR03747 family integrating conjugative element membrane protein
Organism
izh  Izhakiella sp. KSNA2
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: QCT21941
UniProt: A0A4P8YM70
LinkDB
Position
complement(4470299..4471063)
AA seq 254 aa
MAEPQRDTRTPARQEREKAHGLLYNLLWGWLWALFGMLLGSLMLSLLMEYIGIAFFWPEA
GAAHSEAVMNTELGWLSTEFTRSLLLSTPSVTVVNWMTTAYQWLFVNSGVTDWIQQQYAL
QMGSDNELTRQLSGWSGWLAGYLHEYLMATVWVTIITLIRVTILALSLPLFAMAVLVALV
EGLGRRDLPRYGAGYESSFVYHHAKKMVRPAVVVPVMLYLSWPTAVYPNLLLLPAAILLG
TAITVTTASFKKYL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggctgagccacaacgggatacccggacgccggcccggcaggagagagagaaagcgcat
ggcctgctgtataacctgctctggggctggctgtgggcgctgttcggtatgctgctgggg
tctctgatgctgagcctgcttatggagtatatcgggatcgcctttttctggccggaagcc
ggcgcggcgcacagtgaagcagtgatgaatactgagctgggctggttgtccacggagttc
acccgcagcctgctgttgtcaaccccctcggtgacggtcgtcaactggatgacgacagca
tatcagtggctgtttgtgaacagcggtgtcacggactggatacagcagcagtatgcactg
cagatgggcagtgataatgaactgacccgccagttgagtggctggagcggatggctcgcc
gggtatctgcatgaatatctgatggccacggtgtgggtcacgataatcaccctgatccgg
gtgacgattctggcgctgtcactgccgttgtttgccatggcggtgctggtagcgctggtc
gaggggctggggcggcgcgatctgcctcgttatggtgccggttatgagagttcgtttgtt
tatcaccatgccaaaaaaatggtgaggccagcagtggtggtgccggtgatgttgtacctc
tcctggccaacggcagtgtatcccaacctgctattgctgccggctgcgattttgctggga
acggcgattacggtgaccaccgcgtcatttaaaaagtacctgtaa

DBGET integrated database retrieval system