KEGG   Izhakiella sp. KSNA2: FEM41_21700Help
Entry
FEM41_21700       CDS       T05975                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
izh  Izhakiella sp. KSNA2
Pathway
izh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:izh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FEM41_21700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:izh02000]
    FEM41_21700
Transporters [BR:izh02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    FEM41_21700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 oligo_HPY SMC_N AAA_16 AAA_29 RsgA_GTPase FtsK_SpoIIIE SnoaL_2 AAA_33 IstB_IS21 AAA_18 MMR_HSR1 DUF87 G-alpha
Motif
Other DBs
NCBI-ProteinID: QCT22071
UniProt: A0A4P8YMJ5
LinkDB All DBs
Position
complement(4623515..4624378)
Genome map
AA seq 287 aa AA seqDB search
MTSSIPAANNAPLLDVRNLHVEFVNGRQTTHAVRGVSFALGREKLAIVGESGSGKSTVGR
ALLRLHAARTRIHADRLQFGDLDLRSASAAQMRALRGGRISMIMQDPKYSLNPVICVGDQ
IAEAWRTHHTGSRKMAREKALAMLEVVRIRDPGRVYRLYPHEISGGQGQRIMIAMMLITD
PELVIADEPTSALDVSVRLQVLGLLDDLVQSRGLGLIFISHDINLVRSFCDRVLVMYAGR
VVESIAARDLDRAQHPYTRGLIAALPELHSRRETLPVLQRQSRWLTE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcctcgatccccgcagcgaataacgcgccgctgctcgacgtgcgtaatctgcac
gttgaatttgttaacggtcgccagactacccacgcggtgcgcggcgtctctttcgcgctg
ggccgtgaaaagctggcgattgtcggtgaatccggctccggtaaatccaccgttggacgg
gcgctgctgcggctgcatgccgcccgcacccgaattcatgccgacagattacagtttggc
gacctggatctgcgtagcgcctctgccgctcagatgcgcgccctgcgcggcgggcggatc
tccatgattatgcaggatccgaaatattccctgaatccggtgatttgcgtgggcgatcag
atagccgaggcctggcggacccaccataccggcagtcgcaaaatggcgcgggaaaaagcg
ctggcgatgctggaagtggtacggatccgcgatccgggtcgggtctaccggctctatccc
catgagatctctggcggccaggggcagcggatcatgattgccatgatgctgattaccgat
cccgaactggtgattgccgatgaaccgacttcggcgctggatgtctcggtacgtttacag
gttctggggctgcttgacgatctggtgcagtcgcgcggactggggcttatctttatcagc
cacgatatcaacctggtgcgcagcttctgcgatcgggtgctggtgatgtatgccggcagg
gtggtggagtccattgccgcacgggatctggatcgcgcgcagcacccctacacccggggg
ctgatcgccgcgctgcccgaactgcatagccgccgcgagacgctgccggtgctgcaacgc
cagagtcgctggctgaccgaataa

DBGET integrated database retrieval system