KEGG   Janthinobacterium sp. B9-8: VN23_00795Help
Entry
VN23_00795        CDS       T04271                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jab  Janthinobacterium sp. B9-8
Brite
KEGG Orthology (KO) [BR:jab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VN23_00795
Enzymes [BR:jab01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VN23_00795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored NAD_binding_8 Thi4 K_oxygenase FMO-like FAD_binding_3 Glutaredoxin NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AMC33257
UniProt: A0A109RUB4
LinkDB All DBs
Position
188487..190031
Genome map
AA seq 514 aa AA seqDB search
MLESNIKSQLAAYLEKLQFPIELIASVDESSSALEMKSLLQEITELSDKITLRFDDAELK
PSFGIARVGEEARVRFAGIPMGHEFTSLVLGLLQVGGHPPKIEAALIEQIKALPGELRFE
TFISLTCQNCPEVVQSLNLMAVLNPKISHVMIDGALYQDEVNARQIMAVPSVYLNGEAFG
QGRMGIEEIVAKLDTGSVERQAEVISGKDQFDLLVIGGGPAGAAAAVYAARKGIRTGVVA
ERFGGQVLDTMSIENFISVQETEGPKLVTALEQHVKQYDVDIMNLQRAESLSLDENGISQ
IRLASGATLKSKSVIIATGARWREMNVPGEKEYRGRGVAYCPHCDGPLFKGKRIAVVGGG
NSGVEAAIDLAGIVEHVTLLEFGAELRADAVLQKKLYSLPNVVVIKQAQTTSVLGDGQKV
SGLQYTDRQTGESHQVDLAGIFVQIGLLPNTDWLKGTLDLSKHGEIEVDNRGQTSLAGVF
AAGDVTTVPFKQIVIAMGDGAKASLGAFDHLMRS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaatccaatattaaatctcaacttgctgcctatttagaaaaactgcaattcccg
attgagctgattgcctccgtagatgaaagcagcagcgcgctagaaatgaaaagcctgttg
caagaaatcaccgagctatcagacaaaatcactctgcgctttgacgatgctgagttgaaa
ccttcatttggtattgcccgtgtcggcgaggaagctcgtgtgcgttttgccgggattccg
atggggcatgagtttacttccctggtgctgggcctgctgcaagtcggtgggcatccgccc
aagattgaagcggcgctgattgagcaaattaaggccttgccgggtgagctgcgttttgaa
acctttatttccctgacttgccagaattgcccggaagtagtgcaatcgcttaatttaatg
gcggtgcttaacccaaaaatcagccatgtgatgatcgatggtgcgctgtatcaggatgaa
gtgaacgcaaggcaaattatggccgtgccttcggtgtatctgaatggcgaagcttttggc
caaggccggatggggattgaggaaatcgttgccaagctcgataccggctcggtagagcgt
caggcggaagtgatttcgggcaaggatcaatttgatttactggtgataggcggcgggcca
gcaggagcggcggcagcggtgtatgcggcgcgtaaaggaattcgtaccggcgtagtggcc
gagcgctttggtgggcaggtgctcgatactatgagtattgaaaactttatttcggtgcaa
gaaaccgaagggcctaagctggtaacggcgctggagcagcatgtaaagcaatacgatgtc
gatattatgaatctgcaacgtgccgaatcgctcagcctcgatgaaaacggtatcagccag
attcgccttgctagtggtgctaccttaaaaagcaaatcggtgattattgcgaccggtgcg
cgctggcgcgaaatgaatgtgcctggcgaaaaagaatatcgtggccggggtgtggcttac
tgcccgcattgcgatggcccgttgtttaaaggtaaacgcattgcagtagtgggcgggggt
aattctggcgtagaagccgcgattgatctggccgggattgtggaacacgttaccctgctg
gagtttggcgcagagctgcgcgccgatgccgtattgcagaaaaaactctatagcctgccg
aatgtggtggtgattaaacaagcccaaaccacatcagtattgggcgatgggcaaaaagtc
agtggcttgcaatataccgatcgtcaaaccggtgaatcgcatcaggtcgacttagcaggg
atttttgtgcaaattggcttgctgcccaatactgattggctaaaaggcacgctggattta
agtaaacacggcgagattgaagtggataaccgcggccaaacttctttagctggcgtgttt
gcagcgggggacgtgaccaccgtgccattcaagcaaattgtgattgcgatgggtgatggt
gcaaaagcttctcttggtgcatttgatcatttgatgcgtagctag

DBGET integrated database retrieval system