KEGG   Janthinobacterium sp. B9-8: VN23_05695
Entry
VN23_05695        CDS       T04271                                 

Definition
(GenBank) AMP nucleosidase
  KO
K01241  AMP nucleosidase [EC:3.2.2.4]
Organism
jab  Janthinobacterium sp. B9-8
Pathway
jab00230  Purine metabolism
jab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VN23_05695
Enzymes [BR:jab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.4  AMP nucleosidase
     VN23_05695
SSDB
Motif
Pfam: AMNp_N PNP_UDP_1
Other DBs
NCBI-ProteinID: AMC34122
UniProt: A0A109RV93
LinkDB
Position
1283431..1284921
AA seq 496 aa
MPYLPEFIAPTRHTDPRDALAQVRLIYESSVAHLRDAMQRFVAGEALPGHVRAYYPFVRI
QTDTVARLTNESAHLSYGFVAGPGSFETSLTRPDLYDRYYLEQFTLLLQSHQNELEVGVS
TQPMPVHFSFAEHDHIEGTLTAERRQLMRDMFDLPDLSAMDDGIANGTYEPKPGEPEPLS
LFTAARVDYSLHRLRHYTGTVPEHFQNFVLFTNYQFYIDEFVRLGHECMQDANSEYVAFV
EPGNVITRRVGLSAEVIDALGAAPPRLPQMPAYHLIRRDNTGISMVNIGVGPANAKTITD
HIAVLRPHAWIMLGHCAGLRNSQQMGDYVLAHGYVREDHVLDEDLPLWVPVPALAEIQLA
LEAAVSQITEMKGAELKRIMRTGTVASTDNRNWELLPDNRPQRRFSQSRAIALDMESATI
AANGFRFRVPYGTLLCVSDKPLHGEIKLPGMANHFYRERVDQHLRIGIRAMELLRDQGEG
QLHSRKLRSFAEVAFQ
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgccttatctacctgaatttattgccccgacccgccatacagatccacgcgatgccctt
gcgcaggtgcgcttgatttatgaaagcagtgtggcgcatttgcgcgatgccatgcagcgt
tttgtggcgggggaagccttgcccggccatgttcgagcctattatccatttgtaagaatt
caaaccgataccgttgcaaggctcactaatgaaagtgcgcatctaagctatggctttgtg
gcggggccggggagttttgaaaccagcttaacccgccctgatctttacgatagatattat
cttgagcaatttactctgctcttacaaagccatcagaacgagctggaagttggcgtaagt
acccagcccatgccagtgcatttttcttttgccgagcacgatcatattgaaggcacactc
accgccgagcgccgccagctgatgcgcgatatgtttgatttgcctgatttgtcggcgatg
gatgatggcattgccaacggcacttacgagcctaagccgggcgagccggagccgctgtct
ttgtttactgcagcgcgggttgattactccctgcaccgcttgcgtcattacacgggcacc
gtgcccgagcattttcagaattttgtgctgttcaccaattaccagttctatatcgatgag
tttgtgcgccttggccatgaatgcatgcaagacgcgaatagcgaatatgttgcctttgta
gagccgggtaatgtgattactcgccgtgtggggctgagtgccgaggtgattgatgcgctg
ggtgcggcaccaccgcgcctgccgcaaatgcctgcttatcatttgattcgccgcgacaat
accggcattagcatggtgaatatcggcgttggtcccgctaatgccaagaccatcaccgac
catatcgccgtcttgcgtcctcatgcgtggatcatgctcggccattgcgctggcctacgt
aattcgcagcaaatgggtgattacgtactggcgcacggctatgtgcgtgaagatcatgtg
ctcgacgaagatttgccactctgggtgccggtgcccgctctggcagaaattcagctcgca
ttagaagccgccgtatcgcaaatcaccgaaatgaaaggggctgagctcaaacgcattatg
cgcaccggcaccgtggcgagtaccgataaccgcaattgggaattgcttcctgacaatcgt
ccacaaagacgctttagccaaagccgtgccattgcgctagatatggaaagcgccaccatt
gccgccaacggtttcagattccgcgtgccttacggtactttgctttgcgtcagcgacaaa
ccgctgcatggtgaaatcaaactccccggcatggcgaatcacttctaccgcgagcgggtc
gatcagcatttacgaattggcattagagcgatggaattgctgcgcgatcaaggcgaaggc
cagctgcatagccgtaagctaagaagttttgctgaggtggcgtttcagtaa

DBGET integrated database retrieval system