KEGG   Janthinobacterium sp. B9-8: VN23_07440Help
Entry
VN23_07440        CDS       T04271                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
jab  Janthinobacterium sp. B9-8
Pathway
jab00260  Glycine, serine and threonine metabolism
jab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VN23_07440 (tdh)
Enzymes [BR:jab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     VN23_07440 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMC34445
UniProt: A0A0X8GKV8
LinkDB All DBs
Position
1650037..1651062
Genome map
AA seq 341 aa AA seqDB search
MKALSKLEAAPGLTMNQVEKPAIGHNDLLIKIKKTAICGTDIHIWKWDDWAQKTIPVPMH
VGHEYVGTVVEIGSEVQGFKIGDRVSGEGHITCGHCRNCRAGRRHLCRNTVGVGVNRPGA
FAEYLVLPAFNAFPIPDDISDDLAAIFDPFGNAVHTALSFNMVGEDVLITGAGPIGIMAV
AIAKHVGARHVVITDVNDYRLDLARKMGATRAVNVLKEDLKDVMNDLKMTEGFDVGLEMS
GNPQAFRTMLETMQHGGKVALLGIPPADTAIDWNQVIFKGLEIKGIYGREMFETWYKMVA
LIQSGLDITPIITHHFHVDEFEQGFEAMLSGQSGKVILSWE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttatcaaaattagaagcagcacccggcctgacgatgaatcaagtcgaaaag
cctgccattggccataacgacctactcattaaaatcaaaaaaaccgccatctgcggcacc
gatattcatatctggaaatgggatgattgggcgcaaaaaaccattcctgtacccatgcac
gttggtcatgagtatgtcggcaccgtggttgaaattggctctgaggtacaaggctttaaa
attggcgatcgtgtctccggcgaaggccatatcacctgtggccattgccgtaattgccgc
gcaggccgccgccatctttgccgcaataccgtcggcgtgggcgtcaatcgccccggcgct
tttgccgaatatctggtactacctgcctttaacgccttccctattcctgacgatatttcc
gacgatttagccgcgattttcgacccattcggcaatgccgtgcataccgcgctatcgttc
aatatggtaggcgaagatgtattgattaccggcgcaggcccgatcggcattatggcggtg
gcgattgccaaacacgttggtgcgcgccatgtggtgatcaccgacgtcaacgactaccgc
ctcgatctagcccgtaagatgggtgcaactcgcgcggtcaacgtcttaaaagaagattta
aaagacgtaatgaacgacttaaaaatgaccgaaggctttgacgtgggtctggaaatgtcc
ggcaacccgcaagcctttcgcaccatgctggaaaccatgcaacacggtggcaaagttgcg
ctgctaggtattccaccggcagacactgccatcgactggaatcaggtgattttcaaaggg
ctggaaatcaagggcatttacggccgtgaaatgttcgagacttggtacaaaatggtcgcc
ctcatccaatctggcctcgacatcaccccgattatcactcatcactttcatgtggatgag
tttgagcagggctttgaggccatgttgtcagggcaaagcggtaaggtgattttgagctgg
gaataa

DBGET integrated database retrieval system