KEGG   Janthinobacterium sp. B9-8: VN23_08165
Entry
VN23_08165        CDS       T04271                                 

Definition
(GenBank) type VI secretion protein
  KO
K11901  type VI secretion system protein ImpB
Organism
jab  Janthinobacterium sp. B9-8
Brite
KEGG Orthology (KO) [BR:jab00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:jab02044]
    VN23_08165
Secretion system [BR:jab02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VN23_08165
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AMC34576
UniProt: A0A109RVH0
LinkDB
Position
1827992..1828558
AA seq 188 aa
MTESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILSDLSGQPKAPLPKLSERRF
INIDRDNFIEVLESISPRLAIQVDNTIAGDGSKLNIELNFYEPKSLDDKNAAAKSTDFNH
FDPISIVNKVAPLKKLYEARQRLRDLLGKLDGNDDLDKLLQDVVANTEGLKEIQSALPAT
PEPAPAAA
NT seq 567 nt   +upstreamnt  +downstreamnt
atgacagaaagcacccaacacaaactggatcgcgttcgccctccccgcgtacaaatcact
tacgacgtagagattggcaatgcgattgagaaaaaagaacttccgctggtggtcggcatt
ctgtctgacctctccggtcagcccaaggcaccgctgcctaaattaagcgagcggcgcttt
atcaatattgatagagataactttattgaagtgctcgaatccatcagcccaaggctggcg
attcaggtggataacaccattgcaggggatggcagcaagctcaatatcgagctgaatttt
tatgagcctaaaagcctggacgataaaaatgcagccgcaaaatcgaccgacttcaatcat
ttcgatccgatcagcatcgtgaataaagtagcgccgctgaaaaagttgtatgaagcccgc
cagcgtctgcgcgatttattaggcaagctcgatggcaatgatgatttggataaattattg
caagacgtggttgccaataccgaaggcctgaaagaaattcaatcggccctgcctgccacc
ccagagcctgcccccgcagccgcttaa

DBGET integrated database retrieval system