KEGG   Janthinobacterium sp. B9-8: VN23_10105Help
Entry
VN23_10105        CDS       T04271                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
jab  Janthinobacterium sp. B9-8
Pathway
jab00020  Citrate cycle (TCA cycle)
jab00270  Cysteine and methionine metabolism
jab00620  Pyruvate metabolism
jab00630  Glyoxylate and dicarboxylate metabolism
jab00680  Methane metabolism
jab01100  Metabolic pathways
jab01110  Biosynthesis of secondary metabolites
jab01120  Microbial metabolism in diverse environments
jab01130  Biosynthesis of antibiotics
jab01200  Carbon metabolism
Module
jab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
jab_M00012  Glyoxylate cycle
jab_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:jab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VN23_10105
   00620 Pyruvate metabolism
    VN23_10105
   00630 Glyoxylate and dicarboxylate metabolism
    VN23_10105
  09102 Energy metabolism
   00680 Methane metabolism
    VN23_10105
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    VN23_10105
Enzymes [BR:jab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     VN23_10105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AMC34937
UniProt: A0A109RVR3
LinkDB All DBs
Position
2250865..2251845
Genome map
AA seq 326 aa AA seqDB search
MKSPIRVAVTGAAGQIGYSLLFRIASGAMLGADQPVILQLLDITPSLPALNGVVMELDDC
AFPLLQGIVQSDDPKVAFKDADIALLVGARPRGPGMERKDLLEANGAIFTAQGKALNEVA
SRDVKVLVVGNPANTNAYIAMKNAPDLNPANFTAMMRLDHNRALTQIAQKTDSVVTDVNK
MIIWGNHSATQYPDLFHATVKGQSASALINDQKWLEADFIPTVQQRGAAIIKARGLSSAA
SAANAAIDHIRNWVLGTADGDWVTMGVPANGEYGYSDLIFGYPVTCKDGKYTIVEGLEIS
AFSRTRMDASAKELSEERDAVKHLLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcacctattcgcgttgccgttaccggcgctgccggccaaattggttatagcctc
ttattccgtattgcatctggcgcgatgctgggtgcggatcagcctgtgattctgcaattg
cttgatatcaccccttccctgcctgcgcttaacggcgtagtgatggaattggatgactgc
gcattcccactattgcaaggcattgtgcaaagtgatgatccaaaagtagcgtttaaagat
gcagacatcgcccttctggttggtgcacgcccacgcggcccaggcatggagcgtaaagac
ctgctcgaagccaacggtgcaatctttactgcgcaaggtaaagcactgaatgaagtggca
tcacgtgatgtaaaagtactagtagtgggcaatccagccaataccaacgcttatatcgcc
atgaagaatgcgccggatctaaacccggccaacttcaccgccatgatgcgtctggatcat
aaccgtgcgctgacacagatcgctcaaaagacagacagcgtagtcactgatgtcaacaag
atgatcatctggggcaatcactctgctacccagtacccagatctattccacgcaactgta
aaaggccaaagcgcttctgccctgatcaacgatcaaaaatggttagaagctgactttatc
cctaccgttcagcagcgaggcgcagccattatcaaggcgcgtggtttatcgtcagctgct
tctgctgccaacgctgcaattgaccatatccgtaactgggtactgggcacagcagatggt
gactgggtcacaatgggcgtacctgcaaatggtgaatacggctatagcgatctgattttt
ggttacccagtaacatgtaaagatggcaaatacaccatcgttgaaggcttggaaatcagc
gcctttagccgcacacgtatggatgccagcgcgaaggaactatccgaagagcgcgatgca
gtgaagcacttgctcggttaa

DBGET integrated database retrieval system