KEGG   Janthinobacterium sp. B9-8: VN23_14025Help
Entry
VN23_14025        CDS       T04271                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
jab  Janthinobacterium sp. B9-8
Pathway
jab00010  Glycolysis / Gluconeogenesis
jab00620  Pyruvate metabolism
jab01100  Metabolic pathways
jab01110  Biosynthesis of secondary metabolites
jab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VN23_14025
   00620 Pyruvate metabolism
    VN23_14025
Enzymes [BR:jab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     VN23_14025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AMC35655
UniProt: A0A109RVW2
LinkDB All DBs
Position
3127731..3129251
Genome map
AA seq 506 aa AA seqDB search
MSALIPGQYGFPLQLKMRYANYINGEWHAPLAGQYFENISPVTGKVICEIPRSDAADIEM
ALDAAHAAKNAWGKTSTTERANILNKIADRIEANLDMLATVETWDNGKPIRETRAADLPL
AIDHFRYFAGAIRAQEGSIGQIDNDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPLSILVLMEVIGDLLPKGVLNIVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYAAQNLIPVTLELGGKSPNIFMPDVMKHDDAFFNKAIEGFVMFALNQGEV
CTCPSRALIHESIYDAFMDRALSRVAAIKQGNPLDATTMLGAQSSMEQMEKISAYLDIGK
QEGAKVLAGGARATLAGELAGGYYIQPTVFQGHNKMRIFQEEIFGPVVSVTTFKDENEAL
EIANDSLYGLGAGLWTRDTHAAYRMGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLGHYQQTKNLLVSYSPDALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcattgattccaggccagtatggttttccactgcaattaaaaatgcgctacgcc
aactatatcaatggcgaatggcatgctccgctggctgggcaatactttgaaaatatcagc
ccagtcactggcaaggtgatttgcgaaatcccgcgctctgatgccgccgatatcgaaatg
gcgctcgacgccgcccatgccgccaaaaacgcatggggcaaaacatcgaccaccgaacgc
gccaatattctgaataaaattgccgatcgtatcgaagccaacctagacatgctggccacg
gtagaaacttgggataacggcaagccaattcgtgaaacccgcgctgctgatttaccctta
gccatcgatcacttccgctactttgccggggcgattcgggcgcaggaaggcagcatcggc
cagatcgataacgatactgtggcctatcattttcatgagccgctaggcgtggttgggcag
attatcccttggaattttccgctgctgatggccacatggaagctggctccggcgctggct
gcgggtaattgcgtggtactcaagcctgccgagcaaacgccactgagcattttagtgctg
atggaagtgatcggcgatttgctgcccaaaggcgtgctcaatatcgtgaacggctttggc
cttgaagcaggcaagccactggcatccaataaacgtatcgccaaaatcgcctttactggt
gagaccaccactggccgtctgattatgcaatacgcggcgcaaaacctgattccggtgacg
ctggagctgggtggcaaatcgccgaatatctttatgcccgatgtgatgaagcacgacgat
gcattctttaataaggccatcgaaggctttgtgatgtttgcgctcaaccaaggcgaagtc
tgcacctgccctagccgtgcattgattcatgaatccatttatgacgcctttatggaccgt
gccctcagccgcgttgcagccattaaacaaggcaatccgctggatgccaccaccatgctt
ggcgcgcaatcctctatggagcaaatggaaaaaatcagcgcttacttagatatcggcaag
caagaaggcgcaaaagtattggcaggcggcgctcgcgcaacgctcgcgggtgaattggca
ggtggctattacatccagccgacggtattccaaggccataataagatgcggattttccag
gaagaaatcttcggccccgtggtttctgtgaccacctttaaagacgaaaacgaagcttta
gaaatcgctaacgattcgctctatggcctaggtgctggcctgtggacccgcgacacccac
gcagcttatcgcatgggccgcgaaattcaagcgggccgggtctggaccaactgctaccac
gcctaccccgcccacgccgcttttggcggctacaaacaatctgggattggccgtgaaaac
cacaaaatgatgctcggtcactaccagcaaaccaaaaacctgctggtgagctacagcccc
gatgcgctagggtttttctaa

DBGET integrated database retrieval system