KEGG   Janthinobacterium sp. B9-8: VN23_15790Help
Entry
VN23_15790        CDS       T04271                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
jab  Janthinobacterium sp. B9-8
Pathway
jab00970  Aminoacyl-tRNA biosynthesis
jab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VN23_15790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:jab03029]
    VN23_15790
Enzymes [BR:jab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     VN23_15790
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     VN23_15790
Mitochondrial biogenesis [BR:jab03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    VN23_15790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMC35953
UniProt: A0A0X8GS85
LinkDB All DBs
Position
complement(3484992..3486440)
Genome map
AA seq 482 aa AA seqDB search
MIEKSVKQLSAMLAAKEISAVEMASEYLARAKAMRDLNAFITLDEDKTFAEAKAADALLA
SGQAGVLTGVPIAQKDIFCQQGWKTTCGSKMLDNFVAPYDANVIELCRKAGLVSLGRTNM
DEFAMGSSNENSFYGAVKNPWDKSAVPGGSSGGSAAAVAARLAPIATATDTGGSIRQPAA
FCGVTGIKPTYGIVSRFGMIAFASSLDQGGPIGKSAEDCALLLNVMAGFDERDSTSLEHA
KEDYSRDLTAPLAGLRIGLPKEYFAEGLASDVAAAVDVAISEYKKLGATIVEVSLPNTKL
SIPAYYVIAPAEASSNLSRFDGVRFGHRAAEYSGLAEMYEKSRAEGFGAEVKRRILTGTY
VLSHGYYDAYYLQAQKIRRIIANDFQTAFEHCDLIAGPVAPTAAWNLGEKNADPTAMYLE
DIYTLAVNLAGLPGMSLPAGFAANGRPVGLQLIGNYFSEAKMLNAAHQLQQVTDWHTRAP
SL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaaatcagtaaaacaactgtcggcgatgctggcagctaaagaaatttctgcg
gtcgaaatggccagcgagtatctggcgcgtgccaaagccatgcgggacttgaatgccttt
attactttggacgaggataaaacctttgccgaagcaaaagccgctgatgcgctgctggca
agtggccaagctggcgtattaacgggtgtaccgatcgcgcaaaaagatattttttgccag
caaggctggaagaccacctgtggctccaaaatgctggataactttgttgcgccctatgac
gccaatgtaatcgagctatgccgcaaggcgggtttggtgagcttgggccgcaccaatatg
gacgagttcgcaatgggctcatccaatgaaaacagcttttacggcgcggtaaaaaatccc
tgggataaatcagcggtgcccggtggctcttcgggtggctcggctgctgcggtggctgca
cgtttggccccgattgctacggcaacggataccggcggatcgattcgtcagcctgcggca
ttttgtggcgtaaccggtattaagcctacttacggcattgtcagccgcttcggtatgatc
gctttcgccagctcgctggatcaaggtggcccgattggtaaaagcgctgaagactgcgcg
ctgctgctgaatgtgatggcgggctttgacgagcgtgattccacatcgctggagcatgcc
aaagaagattacagccgcgatttaaccgcaccgctggcgggtttaagaattggcctgccc
aaggagtattttgccgaagggctggcgagcgacgtcgctgccgccgtggatgtcgccatt
agcgaatataagaagctgggcgcaacgattgttgaagtgagcctaccgaataccaagctg
tcgatccctgcctattacgtgattgctccagcggaggcttcgagtaatctaagccgcttt
gatggcgtgcgttttggtcatcgtgctgcggaatattcgggcttggctgaaatgtatgaa
aaaagccgtgcagaaggcttcggtgcggaagtaaaacgccgcatcctgaccggtacctat
gtactgagccacggttattacgatgcttactatctgcaagcgcaaaaaattcgccgcatt
atcgccaatgatttccaaactgcgtttgagcattgtgatctgatcgccgggcctgttgcg
ccaacggccgcgtggaatctgggcgagaaaaatgccgacccaactgcgatgtatttagaa
gatatctacacgttggcggtgaatttggcaggcttgccaggcatgagcttgccagcaggc
tttgccgcaaatggccgtccggttggcttgcaactgattggcaactatttcagtgaagcc
aaaatgctgaatgcggcgcatcaattgcagcaagtcacagactggcacacgcgtgcgccc
agcctttaa

DBGET integrated database retrieval system