KEGG   Janthinobacterium agaricidamnosum: GJA_113Help
Entry
GJA_113           CDS       T03157                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jag  Janthinobacterium agaricidamnosum
Brite
KEGG Orthology (KO) [BR:jag00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GJA_113 (ahpF)
Enzymes [BR:jag01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GJA_113 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like DAO Thioredoxin_3 FAD_oxidored NAD_binding_8 Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: CDG80781
UniProt: W0UYQ9
LinkDB All DBs
Position
123761..125359
Genome map
AA seq 532 aa AA seqDB search
MLDATLKTQLKAYLEKVVQPIEIVASLDDSAKAREMQELLQEIVLLSDRITLVERRDDQE
RKPSFSINRPGSDIGVRFAGIPMGHEFTSLVLALLQVGGHTIKLDDAVVEQIRNLDGDYA
FETYISLSCHNCPEVVQALNAMSVINPRIRAVTIDGGVFPKEVEERSIMAVPMMFLNGEP
FGQGRTGVEEILAKLDVNAGARQAAELSKKDVFDVLIVGGGPAGAAAAIYAARKGIKTGV
LAERFGGQVLDTMAIENFISVKETDGPKFAVALEQHVKQYEVDIMNTQRADKLSAAGKLI
EIKTATGAVLKSKTVILATGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGLVKHVTLIEYGDQLRADAVLQRKLHSLPNVTVIMSAQTTEIHGDGKI
VNGLSYKDRVSGSDNKVELEGVFVQIGLVPNTEWLKGTLALSRHGEIEIDARGQTSIPGV
FAAGDVTTVPYKQIIIATGEGAKAALSAFDHLIRSDDEEVVEESAQKVAMTA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaacgctcaaaacccagttgaaagcctatttggaaaaggtcgtgcagccg
attgagatcgtcgcgtctctcgatgacagcgccaaggcccgcgaaatgcaggaactgctc
caggagatcgtcctgttgagcgaccgcatcacgctggtggaacgccgcgacgaccaggaa
cgcaaaccttcgttcagcatcaaccgcccaggcagcgatatcggcgtacgtttcgccggc
atcccgatgggccacgaattcacctcgctggtgctggcgctgctgcaagtcggcggccac
accatcaagctcgacgacgccgtcgtcgagcaaatccgtaacctcgacggcgattacgcc
ttcgagacctacatctcgctgagctgccacaactgccctgaagtggtgcaggcgctgaat
gcgatgtcggtgatcaacccacgcatccgcgccgtcaccatcgacggcggggtgttcccg
aaagaagtcgaagaacgcagcatcatggccgtgccgatgatgttcctgaacggcgagccg
ttcggccagggccgtaccggcgtcgaagaaatccttgccaagctggacgtcaatgccggc
gcacgccaggctgccgaactgagcaagaaagacgtgttcgacgtgctgatcgtcggcggc
ggcccggccggcgcggcagcggcgatctacgccgcccgcaaaggcatcaagaccggtgtg
ctggccgagcgtttcggcggccaggtgctggacaccatggccatcgaaaactttatttcg
gtcaaggaaaccgacggtccgaaatttgccgtggcattggaacagcacgtcaagcaatac
gaagtcgatatcatgaatacccagcgcgccgacaagctgagcgccgccggcaaactgatt
gaaatcaagaccgccaccggcgcggtgctgaaaagcaaaaccgtgatcctggcgaccggc
gcccgctggcgcgaaatcaatgtgccgggcgagaaggaataccgcaaccacggcgtggcg
tactgcccgcattgcgatggtcctttgttcaagggcaagcgggtggcggtgatcggcggc
ggcaactccggcgtcgaggcggcgatcgacctggccggcctggtcaagcatgtgacgctg
atcgaatacggcgatcaattgcgtgccgacgcggtgctgcaacgcaaattgcacagcttg
ccgaacgtgaccgtgatcatgtcggcgcaaaccaccgagatccatggcgacggcaagatc
gtcaatggcctgagctacaaggaccgcgtgtccggcagcgataacaaggtcgagctggaa
ggcgtgtttgtgcaaatcggcctggtgccgaacaccgagtggctgaaaggcacgctggcg
ctgtcgcgtcacggcgaaatcgaaatcgatgcgcgtggccagacttcgattcctggcgtc
ttcgccgccggcgacgtgaccaccgtgccgtacaagcagatcatcatcgccaccggcgaa
ggcgccaaggcagccttgtccgcgttcgatcacctgattcgttcggacgatgaagaagtg
gtggaagagtcggcgcagaaagtcgcaatgaccgcctga

DBGET integrated database retrieval system