KEGG   Janthinobacterium agaricidamnosum: GJA_1412Help
Entry
GJA_1412          CDS       T03157                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
jag  Janthinobacterium agaricidamnosum
Pathway
jag00620  Pyruvate metabolism
jag00680  Methane metabolism
jag01100  Metabolic pathways
jag01120  Microbial metabolism in diverse environments
jag01200  Carbon metabolism
Module
jag_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:jag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GJA_1412 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    GJA_1412 (ppc)
Enzymes [BR:jag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GJA_1412 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CDG82065
UniProt: W0V3A1
LinkDB All DBs
Position
complement(1560595..1563438)
Genome map
AA seq 947 aa AA seqDB search
MVKEASATDVQTGSDKDAPLKEDIRLLGRLLGDVLRDQEGDAVFAVVETIRQTAVRFRRE
ADASAAEELDGLLKQLSREQTISVVRAFSYFSHLANIAEDQHHIRRRRAHLLAGSPAQQG
SVNYALCKLKHAGVSKETVDTFFKEALISPVLTAHPTEVQRKSILDAEHDIARLLAERDL
PLTPKERIANLQMLHARIATLWQTRMLRYSKLTVSDEIENALSYYRITFLRELPGLYDDI
EADIASQYPSDNGGEEKIDASSVQMGSWIGGDRDGNPNVNAGTMQHALARHATTILDFYL
EEVHALGAELSISTLMIGVDPALQALADQSPDASPHRSDEPYRRALIGIYARLAATARFL
GATNILRKEVGAAAPYQAAGEFSADLQVLVTSLQDNHGAALVKPRLATLKRAADIFGFHL
ASLDMRQTSDIHERVLAELFAKSAVESDYSALGEAQKEQLLLSELAQPRLLYSPYITYSE
ESDSELSILRAAKEIRQRYGDRAIRNYIISHTETVSDLLEVMLLQKETGLLRTDWASGDS
ESDLMVIPLFETIPDLQRAADIMGRFMALPQVKQLIAKQGQLQEVMLGYSDSNKDGGFLT
SNWELYKAEIGLVDDFNKAGVKLRLFHGRGGTVGRGGGPSYEAILAQPRGTVNGQIRLTE
QGEIIASKFSNADIGRRNLELLVAATLEASLMPSQSESGPGRQLALFEATMAQLSDLAYH
AYRDLVYETPGFTEYFFAATPLAEIAELNLGSRPASRKANKRIEDLRAIPWGFSWGQCRL
LLPGWYGFGSAIGSWINAEDGKHGASKDDKIATLRAMYRDWPFFATLLSNMDMVLAKTDL
AIASRYAELVSDSELRERIFKRITDEHGATIQCLELITGNTERLAGNPLLARSIMNRFAY
LDPLNHLQVELIKRHRALSAEARVDERVHRGIQLSINGVAAGLRNTG
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagctagtgcaacagacgttcaaacgggctcggacaaagacgctccgctc
aaagaagacatccgcctgctcggccgcctgctcggcgacgtgctgcgcgaccaggaaggc
gacgcggtgtttgccgtggtcgaaaccatacgccagaccgccgtgcgcttccgccgcgaa
gccgacgccagcgccgcggaagaactcgatggcttgctgaaacaattgtcgcgtgaacaa
accatttcggtggtgcgcgccttttcctacttttcccatctggccaatatcgccgaggac
cagcaccacatccgccgccgccgcgcccatttgctggccggctcgccagcccagcaaggc
agcgtcaattatgcgctatgcaagctcaagcatgccggcgtgtcgaaggagacggtcgac
accttcttcaaggaagcgctgatttcgccggtgctgacggcccatccgaccgaagtgcag
cgcaagagcatcctcgacgcggaacacgacatcgcgcgcctgctggccgagcgcgacttg
ccgctgacgccgaaagagcgcatcgccaacctgcaaatgctgcatgcgcgcatcgccacg
ctgtggcaaacccgcatgctgcgctattccaagctgaccgtcagcgatgaaatcgaaaac
gcgctgtcgtattaccgcatcaccttcttgcgcgaattgccgggcctgtacgacgatatc
gaagccgacatcgccagccagtatccgtcagacaatggcggagaagaaaagatcgacgcc
tcgtcggtgcagatgggcagctggatcggcggcgaccgcgacggcaacccgaacgtcaac
gccggcaccatgcagcacgcgctggcgcgccacgccaccaccatcctcgacttttacctg
gaggaagtgcatgcgctgggcgccgaattgtcgatctcgacgctgatgatcggcgtcgat
ccggcgttgcaggcgctggccgaccagtcgccggacgcctcgccgcaccgcagcgacgaa
ccgtaccggcgcgcgctgatcggcatctatgcccggctggccgccaccgcgcgcttcctc
ggcgcgaccaatatcctgcgcaaggaagtcggcgccgccgcgccctaccaggccgccggc
gaattctcggccgacctgcaagtgctggtcacgtcgctgcaagacaaccatggcgccgcg
ctggtcaagccgcgcctggccacgctgaaacgcgcggccgacattttcggcttccacctg
gcctcgctggacatgcgccagacctccgacatccatgagcgggtactggccgagctgttc
gccaagagcgccgtcgaaagcgattattcggccctcggcgaagcgcagaaggaacagttg
ctgctgtccgaactggcccagccgcgcttgctgtattcgccgtacatcacttacagcgag
gaaagcgattcggaattatcgatcttgcgcgcggccaaggaaatccgccagcgttatggc
gaccgggcaatccgcaactacatcatttcgcacaccgaaaccgtgtccgacctgctggaa
gtgatgctgctgcaaaaagaaaccggcttgctgcgcaccgactgggccagcggcgacagc
gagagcgacctgatggtgatcccgctgttcgaaaccatccccgacttgcagcgcgcggcc
gacatcatgggccgcttcatggccctgccacaagtaaaacaattgatcgccaagcaaggc
caattgcaggaagtcatgctcggttattccgactccaacaaggacggcggtttcctgacc
tccaactgggaattgtacaaggctgaaatcggcctggtcgacgacttcaacaaggccggc
gtcaagctgcgcctgttccatggccgcggcggcaccgtcggccgcggcggcggcccgagc
tatgaagcgatcctggcgcagccgcgcggcacggtcaacggccagatccgcctgaccgaa
cagggtgaaatcatcgcctccaagttttccaacgccgacatcggccgccgcaacctggag
ttgctggtcgccgcgacgctggaagcgagcctgatgccgagccagtccgaatcaggaccc
ggccggcaactggcgctgttcgaggcgacgatggcgcaattgtccgacctcgcgtatcac
gcctaccgcgacctggtgtatgaaaccccgggtttcaccgagtattttttcgccgccacg
ccgctggccgaaatcgccgagctgaacctcggttcgcggccggcctcgcgcaaggcgaac
aagcgcatcgaagacttgcgcgcgattccgtggggcttttcgtggggccagtgccgcttg
ctgctgcccggctggtacggtttcggcagcgccatcggcagctggatcaacgccgaggat
ggcaagcacggcgcctcgaaagacgacaagatcgccacgctgcgcgcgatgtaccgcgac
tggccgttcttcgccacgctgctgtcgaatatggacatggtgctggccaagaccgacctg
gcgatcgcgtcgcgctacgcggagctggtcagcgatagtgaattgcgcgaacgtatcttc
aagcgcatcaccgacgagcatggcgcgaccatccagtgcctggagctgatcaccggcaat
accgaacggctggccggcaatccgctgctggcgcgctcgatcatgaaccgcttcgcctat
ctcgatccgctgaatcacttgcaggtcgaactgatcaagcgccaccgcgcgctgtcggcc
gaagccagggtcgatgagcgggtccatcgcggcattcaattgtcgatcaacggcgtcgcg
gcgggcttgcgcaataccggctga

DBGET integrated database retrieval system