KEGG   Janthinobacterium agaricidamnosum: GJA_1739Help
Entry
GJA_1739          CDS       T03157                                 

Definition
(GenBank) NRPS II ORF 1
Organism
jag  Janthinobacterium agaricidamnosum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CDG82375
UniProt: W0V446
LinkDB All DBs
Position
1898131..1903404
Genome map
AA seq 1757 aa AA seqDB search
MNQATAVRNFPRNMVEHLQTLARTRPRDTALIALGAGGESRFDYGQLDQLARAMAVQLQA
RFGPGERALLLLDNDQHYLVAFFGCLYAGLVAVPVFPPESAREQHLERLLAIAADAGACC
ILGTGAILALLGEDGGAARFGAAAALAVDALDPASAGAWRAHVPQETDIAFLQYTSGSTA
VPKGVMVSHANLMANERAIESSMAVTADDVFVTWLPLYHDMGLIGGALQPLHRGIPVVLM
SPSYFLQRPLRWLEAVSRYRGTVSGGPDFAFRLCLERIKPEQAAALDLSSWRVAFSGAEP
VRHDTLSDFMARFAPAGLRPSAIYPCYGLAEATLLVSGGVAGSGMTSTRFAETSVAAGLP
LAATGDQPQSELVGCGPVTAGHRVDIVAPDTLRTLADGQVGEILASGPSVAAGYWRRTDA
SAETFIERDGRRCLRTGDLGFMHQGQLYITGRLKDVIILRGQNFYPQDIERAIEMEVEAV
RKGRVAAFAVSAADGGEGVGVCAEVSRGLQKLVPPAALAEALSQAASLVCRNALTLVVLL
NPGGLPKTSSGKLRRGACRQGWLDGTLDAYAVWSEGRIVQGAAASANPADAGQAPRPGTE
SELAQLWREVLKLDPAAPLRRDAHFFGKGGNSLAAVQLAARAGARWNIDIAPQLLFEHPQ
LADCALRIDGLRSAGAARGSGIAVLPEALRGAGVPLSHAQQRLWFLWRLDPAGTAYHIGG
RLTLDGALDVASLDAALLHLLQRHESLRTSFRAGADGSAEQLIGAAPAQSGLLRLAQDDD
GARLLEQPFDLTQGPLLRAGLRRDAGQRHTLVLVLHHIIADAWSMQRLIEELAACYQAYR
GGAEPALPALPVQYADYAAWQRQRLDGGERVRQLDYWRGALGSHHPVLDLRTDRPRGAAR
RYTAAQHGFTLPPGLAADLRARAGQAGATLFSVLLAAFQALLFRHSGQQDLRIGVPVANR
GRPEVEGVVGFFVNTQVLRSQLGPRMTLAALLQQARVAALGAQAHQELPFDELVEALQPQ
RSLSHNPLFQVLFNHLVEDYRALSALPGLALEVRALEQPEVQFDLALDTVETPDGQLRVA
FSYAAELFDATTIAGYGRHYLALLRQLAAAPECALAEVDLDGAAGRAQLLAWGRNDGAAL
ATLPAHLRFERQAAAQPHAEALVCGAEALTYDALNRRANRLARRLMADGAGPGTLVGVAL
ERSPDMVVGLLAILKAGAAYVPLDPDYPAGRLLHMARDSGLAMLLTHSRLDARLPALDGV
ARLRLDGLALDGLSDANPGVAVHGDSLAYVIYTSGSTGTPKGVGIGHAALARHIDVSAQF
FGLRADDRMLQFATLNFDGFIEQLFPPLALGAAVVLRGPDLWDSAAFYEQLIAQRISVAD
LTTAYWAVLAQDFAGHGRRDYGALRQVHAGGEALPPEALHAWRDAGLQHVKLLNTYGPTE
ATVTASALDCAPYLAPGARLPAQMPIGAPLAGRRLYVLDSELGLAPPGVAGELYIGGALL
ARGYLNRPGLSAERFVADPFGADGGRLYRSGDLVRWLADGQLEYLGRIDHQVKLRGLRVE
LGEIEARLLAQPGVRAAVVSTQQAGSGALLVAHVAADPGVELQGAALRSALRGELPDYMV
PSAVMVLAALPLNPNGKVDRHALPLATPSADAEHVAPLGQAEQALALLWQEVLGLPRVGR
HDNFFELGGHSLAAIRVTALLAQRHACELPVRRFFDAPTLAGMAQGLSEAGFDAGGAARA
RRLDDMANLLSEFEEQE
NT seq 5274 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggcaaccgcagttcgtaactttccgcgcaatatggtcgagcacctgcaaacc
ctggcccgcacgcggccgcgcgacaccgcgctgatcgcgctgggcgccggcggcgagagc
cgcttcgactacggacaactggaccagctggcgcgcgcgatggcggtgcaattgcaggcg
cgtttcggccccggcgagcgtgccttgctgctgctcgacaatgaccagcattacctggtc
gccttcttcggctgcctgtacgccggcctggtcgcggtgccggtgtttccgcccgaatcg
gcgcgcgaacagcacctggaacgcttgctggcgatcgccgccgacgccggcgcctgctgc
atcctcggcaccggcgcgatcctggcgctgctgggcgaggatggcggcgcggcccgtttc
ggcgccgccgccgcgcttgccgtcgatgcgctggatccggcaagcgccggcgcatggcgc
gcccacgtgccgcaagagaccgacatcgccttcctgcaatacacctccggctcgaccgcc
gtgccgaagggggtcatggtcagccacgccaacctgatggccaacgagcgcgcgatcgag
tccagcatggcggtgacggccgacgacgtgttcgtcacatggctgccgctgtaccacgac
atgggcctgatcggcggcgcgctgcagccgctgcaccgcggcattccggtggtgctgatg
agtccatcgtacttcctgcagcgtccgctgcgctggctggaagcggtgtcgcgttatcgc
ggcaccgtcagcggcggaccggacttcgccttccgcctgtgcctggagcgcatcaagccg
gagcaggccgcggcgctcgacctgtccagctggcgggtcgcgttttccggcgccgagccg
gtgcggcacgatacgctgagcgacttcatggcccgcttcgcgccggccggcttgcggccg
tcggcgatctatccgtgctacggcctggccgaggcgacgctgctggtcagcggcggcgtg
gccggctccggcatgacgtcgacgcgctttgccgagaccagcgtggccgccgggctgccg
ctggccgccaccggcgatcagccgcagagcgagctggtcggctgcggcccggtcaccgcc
ggccatcgggtcgacatcgtcgcgccggacacgctgcgcacgctggccgacggccaggtc
ggcgaaatcctggccagcggccccagcgtggcggccggctactggcgccggaccgacgcc
agcgcggagacctttatcgaacgcgacggccggcgctgcctgcgcaccggcgacctggga
ttcatgcaccaggggcagctgtacatcaccggccggctgaaggatgtgatcatcctgcgc
ggccagaatttctatccgcaagacatcgagcgcgccattgaaatggaagtcgaggcggtg
cgcaagggccgggtggcggccttcgcggtgtccgcagccgatggcggcgagggcgtcggc
gtgtgcgccgaagtgtcgcgcggcctgcaaaaactggtgccgccggccgcgctggccgag
gcgctgagccaggccgccagcctggtgtgccgcaatgcgctgacgctggtggtgctgctc
aatccgggcggactgccgaagacatcgagcggcaagctgcgccgcggcgcctgccgccag
ggctggctggacggcacgctggacgcctacgcggtctggtcggaaggccgcatcgtgcag
ggcgccgccgcctctgccaatcctgccgatgccggccaggcgccccggccgggcaccgaa
agcgaactggcccaattgtggcgcgaggtgctgaagctggacccggccgcgccgctgcgg
cgcgacgcgcatttctttggcaagggcggtaattcgctggccgccgtgcaactggcggcg
cgcgccggcgcgcgctggaatatcgacatcgcgccgcaattgctgttcgagcatccgcag
ctggccgattgcgcgctgcgcatcgacggcttgcgcagcgccggcgcggcgcgcggcagc
ggcatcgccgtgctgcccgaggcgctgcgcggcgccggcgtgccgctgtcgcacgcgcag
cagcggctgtggttcctgtggcgcctcgacccggctggcaccgcctaccatatcggcggc
agactgacgctggacggcgcgctggatgtggccagcctggacgcggcgctgctgcatctg
ctgcaacgccacgaatcgctgcgcaccagcttccgcgccggcgccgacggcagcgccgaa
caactgatcggcgccgcgccggcgcaatcgggcctgctccggctggcgcaggacgacgac
ggcgcgcggctgctggagcagccgttcgacctgacgcagggcccgctgctgcgcgccggc
ctgcgccgcgacgccggacagcgccacacgctggtgctggtgctgcaccatatcatcgcc
gacgcgtggtcgatgcagcgcctgatcgaagagctggcggcctgctaccaggcgtaccgc
ggcggcgccgaaccggccttgccggcgctgccggtgcaatacgccgattacgccgcctgg
cagcggcagcggctggacggcggcgaacgggtgcgccagctggactattggcgcggcgcg
ctgggcagccatcatccggtgctcgacttgcgcaccgaccggccgcgcggcgcggcgcgc
cgctacacggcggcgcagcacggcttcacgctgccgccgggcctggcggcggacttgcgg
gcccgggccgggcaagccggcgccacgctgttcagcgtgctgctggcggcgttccaggcg
ctgctgttccgccacagcggccagcaagacttgcggatcggcgtgccggtggccaaccgc
ggccgtcccgaagtcgagggcgtggtcggctttttcgtcaacacccaggtgctgcgcagc
cagctcgggccgcgcatgacgctggccgcgctgctgcagcaggcgcgcgtcgcggcgctg
ggcgcgcaggcgcaccaggaattgccgttcgatgaactggtcgaggccttgcagccgcag
cgcagcctgagccacaacccgctgttccaggtcttgttcaaccacctggtggaagattac
cgcgcgctgtccgcgctgccgggcctggcgctcgaggtgcgggcgctggagcagccggag
gtgcagttcgacctggcgctggacaccgtcgaaacgccggacggccagttgcgggttgcc
ttcagttacgcggccgaactgttcgacgcgaccaccatcgccggctatggccggcattac
ctggcgctgctgcgccagcttgccgccgcgcccgaatgcgcgctggccgaggtcgacctg
gacggcgcggccggccgcgcgcagttgctggcctggggccgcaacgacggcgcggcgctg
gccacgctgccggcccacctgcgcttcgagcgccaggcagccgcccagccgcacgccgag
gcgctggtgtgcggcgccgaagcgctgacctacgacgccctgaaccgccgcgccaaccgg
ctggcgcggcgcctgatggccgatggcgccgggccgggcacgctggtcggcgtggcgctg
gaacgctcgccggacatggtggtgggcttgctggcgatcctgaaggccggcgccgcctac
gtgccgctcgacccggattatccggccggccggctgctgcacatggcgcgcgacagcggc
ctggccatgctgctgacgcacagccggctggacgcgcgcctgccggcgctggacggcgtc
gcgcggctgcggctggacggcctggcgctggacgggctgtccgacgccaatcccggcgtg
gccgtgcacggcgacagcctggcctatgtgatctacacctccggctcgaccggcacgccg
aagggcgtcggcatcggccacgcggcgctggcgcgccatatcgacgtgtcggcgcaattc
ttcggcctgcgcgccgacgaccgcatgctgcaattcgccacgctcaatttcgacggcttc
atcgaacagctgttcccgccgctggcgctgggcgcggcggtggtgctgcgcggtcccgac
ctgtgggatagcgcggccttttatgagcaactgatcgcgcagcgcatcagcgtggccgac
ctgaccaccgcctactgggccgtgctggcccaggattttgccgggcacggccggcgcgat
tacggcgcgctgcgccaggtgcacgccggcggcgaggcgctgccgccggaagcgctgcat
gcgtggcgcgacgccgggctgcagcacgtcaagctgctcaatacctatggcccgaccgag
gccaccgtcaccgccagcgcgctcgattgcgcgccttacctggcgccgggcgcgcgcttg
ccggcgcagatgccgatcggcgcgccgctggccggacgccgtttatacgtgctcgattcc
gagctgggcctggccccgccgggcgtggccggcgagctgtacatcggcggcgcgctgctg
gcgcgcggctacctgaaccggcctggcctgagcgccgagcgcttcgtcgcggacccgttc
ggcgccgatggcgggcggctgtaccgcagcggcgacctggtgcgctggctggccgatggc
cagctcgaatacctggggcgcatcgaccaccaggtcaagctgcgcggcctgcgcgtcgag
ctgggcgagatcgaggcccgcctgctggcccagccgggcgtgcgcgcggccgtcgtcagc
acccagcaggccgggtccggcgcgctgctggtggcgcacgtggccgccgatcccggcgtc
gagctgcagggcgctgcgctgcgcagcgcgctgcgcggggaactgcccgactacatggtg
ccgtcggccgtgatggtgctggccgccttgccgctgaacccgaacggcaaggtcgaccgg
catgcgctgccgctggcgacgccgtcggccgatgccgaacatgtggcgccgctgggccag
gccgaacaggcgctggcgctgttgtggcaagaggtgctggggctgccgcgggtgggccgg
cacgacaatttttttgagctgggcggccattcgctggcggcgatccgggtcaccgccttg
ctggcgcagcgccacgcctgcgaactgccggtgcggcgcttcttcgacgcgccgacgctg
gcgggcatggcgcagggcctgtccgaggccggcttcgacgccggcggcgcagccagggcg
cgccggctggacgacatggccaatcttttaagcgaattcgaggaacaggaatga

DBGET integrated database retrieval system