KEGG   Janthinobacterium agaricidamnosum: GJA_2749Help
Entry
GJA_2749          CDS       T03157                                 

Gene name
SOD1
Definition
(GenBank) superoxide dismutase [Cu-Zn] domain protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
jag  Janthinobacterium agaricidamnosum
Brite
Enzymes [BR:jag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GJA_2749 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CDG83380
UniProt: W0V6Z9
LinkDB All DBs
Position
complement(3027913..3028572)
Genome map
AA seq 219 aa AA seqDB search
MLSALQPVPAGAPEEGVCIYRAGSQPATHGIDKKYTFSGEFWMKHISLILLSAVAIAGCA
TQPVAPSAGLVANAVLKPTQGNQAGGSVRFEEKNGQVWVIASIEGLSPGQHGFHIHEKGD
CSSPDGLSAGGHFNPTGVQHGNPASGPHHGGDFGNLETDMNGNAELKMAFPLSQISLDKD
APNSIIGRGLIVHADPDDFRTQPTGNSGKRLACGVIVLK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcggcgttgcagcctgtcccggcaggggcgccagaagagggcgtatgcatctac
cgggcaggctcgcagccagccactcacggcatcgacaaaaaatacactttctcgggagaa
ttttggatgaaacatatttcgctgatccttttgagcgccgtcgccatcgccggttgcgcc
acccagcctgtggcgccgtcggccggactggtcgccaacgcggtgctgaaaccgacccag
ggcaatcaagccggcggcagcgtccgttttgaagaaaagaatggccaggtctgggtcatc
gccagtatcgagggcttgtcgcctggccagcatggattccatatccatgaaaaaggcgat
tgcagctcgccggatggactcagcgcgggcgggcattttaatccgactggcgtgcagcat
ggcaatccggccagcggcccgcaccatggcggcgacttcggcaatctggaaacggatatg
aatggcaatgcggaattgaaaatggcatttccactgagccagatatcgctggacaaggat
gcgcccaacagcattatcggccgcggtttgatcgtgcacgccgatccggatgatttcagg
acccagccgaccggcaattcgggtaaacggctggcttgcggcgtgatcgtactgaaataa

DBGET integrated database retrieval system