KEGG   Janthinobacterium agaricidamnosum: GJA_2942Help
Entry
GJA_2942          CDS       T03157                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
jag  Janthinobacterium agaricidamnosum
Pathway
jag00473  D-Alanine metabolism
jag01100  Metabolic pathways
jag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:jag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GJA_2942 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GJA_2942 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jag01011]
    GJA_2942 (alr)
Enzymes [BR:jag01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GJA_2942 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:jag01011]
 Precursor biosynthesis
  Racemase
   GJA_2942 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CDG83568
UniProt: W0V897
LinkDB All DBs
Position
complement(3214265..3215377)
Genome map
AA seq 370 aa AA seqDB search
MPPKNRSGAILTVDLDAIRANYRLLRQRAQPATCSAVLKSDAYGLGAAPIAAVLYDEGCR
HFFVAHLDEGITLRQSLAPDAAIFVLHGPPVDTEAEFIASQLIPVLNSTQQVAGWSAHAA
LLGRSLPAIVQVDSGMSRMGLSPAEVDAWLEDPHFLDGIELQYLMSHLACADERDNPMNA
MQLERFQAIRARLPACPASLANSSGIFLSGAYHFDLVRPGAALYGIAPHRDAANPMAPVV
RLQGKVVQTRTIERGDHVGYSLRYTASETRQVATVSVGYADGWLRSMSNHGVAIVDGVRV
PQIGTISMDTITLDVSAIPRERVLPGSLVDLICAEHPVDAVAGLANTIGYEVLTNLGSRF
YREYTGAAAG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaagaaccgcagcggtgcgatcctgacggtcgacctggatgcgatccgcgcc
aattaccgcttgctgcgccagcgcgcccagccggccacgtgttcggcggtgctcaaatcg
gacgcttacggcctgggcgcggcgccgatcgcggccgtcctgtacgacgaaggttgccgg
catttctttgtggcccacctggacgagggcatcaccttgcgccagtcgctggcgccggat
gcggcgattttcgtcttgcatgggccgccagtcgataccgaggcggagtttattgccagc
caattgataccggtactcaacagcacccagcaagtggcgggctggtccgcccatgccgcg
ttgctgggccgcagcttgccggcgattgtgcaagtcgatagcggcatgtcgcgcatgggc
ttgtcgccggctgaagtcgatgcgtggctggaagatccgcacttcctcgacggcatcgag
ttgcaatacctgatgagccacctggcctgcgccgacgagcgcgacaatccgatgaatgcc
atgcagctggaacgcttccaggcgatccgcgcgcgcttgccggcatgcccggccagcctg
gccaattcctcgggcattttcctgtccggcgcctaccatttcgacctggtgcgtccgggc
gcggcgctgtacggcatcgcgccgcacagggatgcggccaatccgatggcgccggtggtg
cgcctgcaaggcaaggtggtgcaaacccgcaccatcgagcgtggcgaccatgtcggctac
agcctgcgttataccgccagcgagacgcggcaggtggcgaccgtgtcggtcggctacgcc
gacggctggctgcgcagcatgagcaatcacggcgtcgccatcgtcgatggcgtgcgggtg
ccgcagatcggcaccatttcgatggatacgattaccctcgacgtcagcgcgatcccgcgc
gagcgggtgctgccgggcagcctggtcgacctgatttgcgccgaacacccggtcgatgcg
gtggccgggctggccaataccatcggttatgaagtgctgaccaatcttgggtcgcgtttt
taccgcgaatataccggtgcggcagccggttaa

DBGET integrated database retrieval system