KEGG   Janthinobacterium agaricidamnosum: GJA_358Help
Entry
GJA_358           CDS       T03157                                 

Definition
(GenBank) glutathione S-transferase, C-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
jag  Janthinobacterium agaricidamnosum
Pathway
jag00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:jag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GJA_358
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:jag02000]
    GJA_358
Enzymes [BR:jag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GJA_358
Transporters [BR:jag02000]
 Other Transporters
  Pores ion channels [TC:1]
   GJA_358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: CDG81019
UniProt: W0UX10
LinkDB All DBs
Position
434310..434981
Genome map
AA seq 223 aa AA seqDB search
MIVVHHLNNSRSQRVLWLLEELGLEYDIQRYQRDPKTMLAPAALRAVHPLGKSPVITDGG
LTLAESGAIVEYLVESYGRGRLVPAAGTPERLRWRYWLHFAEGSAMPPLLMKLVFDKVES
GPMPFFVRPIARAIAHKVKSGFINPNIRQQLDYMESELSGRQWFAGDEFSAADIQMSFPL
EAAAARGGLGDGRPKLMDFLDRIHARPAYQRALERGGPYELMQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtggtccaccatttgaataattcgcgctcccagcgcgtgctctggctgctggaa
gagctgggcctggaatacgacatccagcgctaccagcgcgacccgaagacgatgctggcg
ccggctgcgctgcgcgccgtccatccgctgggcaagtcgccggtgatcaccgacggcgga
ttgacgctggccgagtcgggcgccatcgtcgaatacctggtcgagtcttacggccgcggc
cggctggttcccgcagccggcacgccggagcggctgcgctggcgctactggctgcatttc
gccgaaggcagcgcgatgccgccgttgctgatgaagctggtgttcgacaaagtcgaaagc
gggccgatgccgtttttcgtgcggccgatcgcgcgcgccatcgcgcacaaggtcaagagc
ggcttcatcaatccgaatatcaggcagcagctcgattatatggaaagcgagctgtccggc
cggcagtggtttgccggcgacgaattttcggcggccgacatccagatgagtttcccgctc
gaagcggccgccgcgcgcggcggattgggcgacggccggccgaaactgatggacttcctg
gaccgcatccacgcgcgtcccgcctaccagcgcgcgctggagcggggcgggccgtatgag
ttgatgcagtaa

DBGET integrated database retrieval system