KEGG   Janthinobacterium sp. 17J80-10: EKL02_01820
Entry
EKL02_01820       CDS       T05896                                 

Gene name
dmpH
Definition
(GenBank) 2-oxo-3-hexenedioate decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
jaj  Janthinobacterium sp. 17J80-10
Pathway
jaj00362  Benzoate degradation
jaj00621  Dioxin degradation
jaj00622  Xylene degradation
jaj01100  Metabolic pathways
jaj01120  Microbial metabolism in diverse environments
jaj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:jaj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EKL02_01820 (dmpH)
   00622 Xylene degradation
    EKL02_01820 (dmpH)
   00621 Dioxin degradation
    EKL02_01820 (dmpH)
Enzymes [BR:jaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     EKL02_01820 (dmpH)
SSDB
Motif
Pfam: WAK
Other DBs
NCBI-ProteinID: QAU33009
UniProt: A0A410UNR4
LinkDB
Position
419447..420301
AA seq 284 aa
MHRRRPRQLPCQICRKERSMSTPTLSREEVVRLTERVEGAQIRAYEIPKLTEEYPGMNIA
DGYAVQKELRQRSIARGNRLIGWKVGLTSKAKMVQMGIHEPSIGFLMNDMACPENSAIDI
SKLVHPRVECEVAFVTKKDLQGPNCTKEQVLDATDFVLPAIEVIDSRFKAFKFDLPSVIA
DNGSSARVVSGGRARYPQDVDLRTLGAVMEKNGEIVSLGASAAVLGHPAEAIACLVNILS
TQGETLPAGSFVMSGGITEAIHVKAGDSIIARFQELGSVSVRFV
NT seq 855 nt   +upstreamnt  +downstreamnt
atgcaccgtcggcggcctcggcagctgccatgtcaaatttgcaggaaggagcgcagcatg
agtacccctacattatctcgcgaagaagttgttcgtttgaccgagcgcgttgaaggcgcg
caaattcgcgcttatgaaattcccaagctgaccgaggaatatccgggcatgaacatcgcc
gatggctatgcggtgcaaaaggaattgcgtcagcgttcgattgcgcgtggaaatcgcctg
atcggctggaaggtcggcctgacttccaaagccaagatggtccagatgggcatccatgaa
ccgagcatcggctttctgatgaatgacatggcctgtccggagaattcagcgatcgacatc
tcgaaactggtgcatccgcgcgtcgaatgcgaagttgcatttgtgacgaaaaaggacttg
cagggtccgaactgcactaaagaacaggtgctcgatgcgaccgacttcgtgctgccggcg
atcgaagtcatcgactcgcgcttcaaggccttcaagttcgacctgcccagcgtaattgcc
gataacggctccagcgcccgggttgtcagcggtggccgggcgcgttatccccaggatgtc
gatttgcgtacgctgggcgcagtgatggaaaagaacggcgagattgtttcactcggggct
tctgccgcggtgctcggtcatcctgcagaagccatcgcttgccttgtcaatatcctcagt
acccagggcgagaccctgccggcaggtagttttgtgatgagcggcggcattaccgaagcg
attcacgtgaaagccggcgacagcatcatcgcgcgattccaggagctgggcagtgtgtcg
gtgcgttttgtctaa

DBGET integrated database retrieval system