KEGG   Janthinobacterium sp. 17J80-10: EKL02_01870Help
Entry
EKL02_01870       CDS       T05896                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jaj  Janthinobacterium sp. 17J80-10
Brite
KEGG Orthology (KO) [BR:jaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EKL02_01870 (ahpF)
Enzymes [BR:jaj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EKL02_01870 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO Glutaredoxin K_oxygenase Thi4 NAD_binding_8 FAD_binding_3 NAD_binding_7 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: QAU33019
UniProt: A0A410UNS8
LinkDB All DBs
Position
434986..436560
Genome map
AA seq 524 aa AA seqDB search
MLETNLKTQLKAYLEKVTLPIEITANIDGTEASREMQGLLTDIATLSDKITLKETSDAAV
RAPSFAINRAGSDMGIRFAGIPMGHEFTSLVLALLQAGGHPPKLDADVIEQIRALEGEFV
FETYISLSCQNCPDVVQALNLMAVLNPNIRHVMVDGALYQDEVEKRQIMAVPTVVLNGEV
FGQGRMGTEEILARIDTGASARAAEKLAQKDVFDVLVVGGGPAGAAAAIYAARKGINTGV
VAERFGGQVLDTMAIENFISVKETEGPKLAVALEQHVKEYAVDIMNVQRAEKLVAGDIIE
VQLASGATLKARSVILATGARWRQMNVPGEEQYRNKGVAYCPHCDGPLFKGKRVSVVGGG
NSGVEAAIDLAGIVAHVTLLEFGSELRADAVLQRKLYSLPNVTVITDAQTTEVTGDGNKV
NGLKYIDRKSGAAHAIDLEGIFVQIGLLPNTEWLKGTVALSNRGEIEVDARGQTSVPGVF
AAGDATTVPFKQIIIAMGEGAKASLSAFDHLIRTSAPAEEKKAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaccaatctcaagacccaattgaaagcctatctcgaaaaggtcaccctcccc
atcgagatcaccgccaatatcgacggcaccgaggcctcgcgtgaaatgcagggcctgctc
accgatatcgccaccctctccgacaagatcacgctgaaggaaaccagcgacgccgccgtg
cgcgcgccatccttcgccatcaaccgcgccggcagcgacatgggcatccgctttgccggc
atccccatgggccatgaattcacgtcgctggtgctggcgctgctgcaggccggcggccac
ccgcccaagctcgacgccgatgtcatcgagcagatccgcgctctcgaaggcgagttcgtc
ttcgagacctatatctcgctgtcgtgccagaactgcccggatgtggtgcaggcgctgaac
ctgatggctgtgctgaaccccaacatccgccacgtcatggtcgatggcgcgctgtaccag
gatgaagtcgagaagcgccagatcatggccgtgccgaccgtcgtcctgaatggcgaggta
ttcggccaaggccgcatgggcaccgaggaaatcctcgccaggatcgataccggcgcctct
gcgcgtgccgctgaaaagctggcgcagaaagacgtgttcgacgtgctggtggtgggcggt
ggccccgccggcgccgctgcggcaatctatgcagcgcgcaagggcatcaacacgggtgtt
gttgccgagcgctttggcggccaggtgctcgacaccatggccatcgaaaacttcatctcg
gtgaaggaaaccgaaggacccaagctggccgtggcgctcgagcagcacgtcaaggaatac
gccgtcgacatcatgaacgtgcagcgcgccgaaaagctcgtcgccggcgacatcatcgaa
gtacagctggccagcggcgccaccctcaaggccaggtccgtcatcctggccaccggcgcg
cgctggcggcagatgaacgtgcccggcgaagagcagtaccgcaacaagggcgtggcctat
tgcccgcactgcgacggtccgctcttcaagggcaagcgtgtctcggtggtcggcggcggc
aactccggcgtggaagcggccatcgatctggccggtatcgtcgcgcacgtcaccctgctg
gaattcggcagcgaattgcgcgctgacgcggtcttgcagcgcaagctctatagcctgccg
aacgtgaccgtcatcaccgatgcccagaccaccgaagtcaccggcgacggcaacaaggtc
aatggcctgaagtacatcgaccgcaagagcggcgccgcgcacgccatcgatctggaaggc
atcttcgtgcagatcggcctgctgcccaacaccgagtggttgaaaggcacggtggccctg
tcgaaccgcggtgaaatcgaagtcgatgcgcgcggccagacgtcggtgccgggggtgttt
gccgccggggacgccaccacggtgcctttcaagcagatcatcatcgccatgggcgagggc
gccaaggcatcgttgtcggccttcgatcacctgatccgcacgtcagcgccggcagaagaa
aagaaggcggcgtaa

DBGET integrated database retrieval system