KEGG   Janthinobacterium sp. 17J80-10: EKL02_04425Help
Entry
EKL02_04425       CDS       T05896                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
jaj  Janthinobacterium sp. 17J80-10
Pathway
jaj00471  D-Glutamine and D-glutamate metabolism
jaj00550  Peptidoglycan biosynthesis
jaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jaj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EKL02_04425
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EKL02_04425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jaj01011]
    EKL02_04425
Enzymes [BR:jaj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     EKL02_04425
Peptidoglycan biosynthesis and degradation proteins [BR:jaj01011]
 Precursor biosynthesis
  Amino acid ligase
   EKL02_04425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C MarR_2
Motif
Other DBs
NCBI-ProteinID: QAU33487
UniProt: A0A410UQ36
LinkDB All DBs
Position
985789..987189
Genome map
AA seq 466 aa AA seqDB search
MKHKVKNIHFVGIGGSGMSGIAEVLLNLGYTVSGSDLGNNAATQRLAGLGARVLQGHAPE
NIGEADAIVTSTAVKADNPEVIAAREKRIPIVPRAVMLAELMRLKQGIAIAGTHGKTTTT
SLVASVLAEGGLDPTFVIGGRLTSAGANAKLGSGDFLVAEADESDASFLNLSPCIEVITN
IDADHMETYNHDFGKLKQAFVEFTQRLPFYGVAMLCVDDPHVRDIMPQISKPIVTYGFHE
EAQVRAVDARAVNSHMEFTVLQKDYAPLHVRLNQPGMHNVQNACAAIAIARELGVDDAAT
QKALAEFHGVGRRFTRYGEVAIPARDGRPAGTFALVDDYGHHPVETAATLSAARGAYPGR
RLVLAFQPHRYTRTRDLFEDFVKVLSSSDALVLAEVYAAGEQPIVAADGRALAHALRVLG
KVDPVFVENIADMPGTILDIVRDGDVVMTMGAGSISGVPGKLAQGA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacaaggttaaaaacatccatttcgtcggtattggcggctccggtatgagcggc
atcgcggaggtgctgctcaacctcggttataccgtgtccggctcggacctcggcaacaac
gccgccacccagcgcctggcaggcctgggcgcgcgggtgttgcagggccacgcgccggaa
aatatcggcgaggcggatgcgatcgttacttccacggcggtcaaggccgacaatccggaa
gtcattgccgcgcgtgaaaagcgcattcccatcgtgccacgcgcggtgatgctggctgaa
ctgatgcgcctgaagcaggggattgccatcgccggcacccacggcaagaccacgaccacc
agcctggtggccagcgtgctggccgaaggcgggctggacccgactttcgtgatcggcggg
cggctgacttccgccggcgccaatgccaagttgggatcgggcgattttctggtcgccgaa
gcggatgagtcggatgcctcgttcctgaacctgtcgccgtgcatcgaggtcatcaccaac
atcgatgccgaccacatggagacctacaaccacgacttcggcaagctcaagcaggctttc
gtcgaattcacccagcgcctgcctttctatggcgtggccatgctgtgcgtcgacgatccg
catgtgcgcgatatcatgccgcagatttccaagcccatcgtcacctacggtttccacgaa
gaggcgcaggtgcgcgcggtggatgcgcgcgcggtcaacagccacatggaattcacggtg
ctgcaaaaagattacgcgccgctgcatgtgcgcctgaaccagccgggcatgcacaatgtg
cagaacgcctgcgccgccattgcgatcgcgcgcgagctgggggtcgatgacgccgctacg
caaaaggcgctggcggaatttcatggcgtcggccgccgcttcacccgctacggcgaagtc
gcaattcccgccagggatggcaggcccgccggaacgtttgcgctggtcgatgactatggc
caccacccggtggagaccgccgctaccctgtccgcggcgcgcggcgcctacccgggacgg
cggctggtgctggcattccagccgcaccgttacacgcgcacccgcgatctgttcgaggat
ttcgtcaaggtgctgtcgagctcagatgcgctggtgctggcggaagtctatgccgccggc
gagcaacccatcgtcgccgccgacgggcgcgcgctggcacatgccttgcgtgtgctgggc
aaggtcgatccggtgttcgttgaaaatattgctgacatgcccggcaccatcctggacatc
gtgcgtgatggcgatgtcgtgatgacgatgggggcgggctcgatcagcggtgttcccggc
aagcttgcccaaggcgcttga

DBGET integrated database retrieval system