KEGG   Janthinobacterium sp. 17J80-10: EKL02_11530Help
Entry
EKL02_11530       CDS       T05896                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
jaj  Janthinobacterium sp. 17J80-10
Pathway
jaj00790  Folate biosynthesis
jaj01100  Metabolic pathways
Module
jaj_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:jaj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EKL02_11530 (folP)
Enzymes [BR:jaj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     EKL02_11530 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: QAU34765
UniProt: A0A410UTR6
LinkDB All DBs
Position
complement(2570664..2571512)
Genome map
AA seq 282 aa AA seqDB search
MQEFLQCGRYRLALGPKDRPLVMGILNITPDSFSDSGQFMPLDSALDRAEQMIAEGADMI
DIGGESTRPGAPVVSLEEELRRVMPTLYALRDCGKPLSVDTYKPEVMKEALAAGADMIND
INGFNAPGALTAVNESDCGLCIMHMQRDPQTMQAAPVYEDVVRNVTDYLRQRVDAMAAAG
ISRARMCIDPGFGFGKTLAHNLELLKNLEVLLQELQLPLLAGMSRKTMIGMLIGKPVEQR
AAGSVAAALVAAAHGARIVRVHDVAATVDALKVWQASRQDAA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatttttgcaatgcgggcgctaccggctggcgctcggccccaaggatcgtccg
ctggtcatggggattctcaatatcacgccggattcgttttccgacagcggccagttcatg
ccactggactccgccctcgaccgcgccgaacaaatgattgccgaaggcgccgacatgatc
gatatcggtggcgagtcgacccggccgggcgctcccgtagtgtcgctggaagaagagttg
cggcgggtcatgccgactctctatgcattgcgcgattgcggcaagccgctttcggtggat
acctacaagcccgaagtcatgaaagaggcattggccgcgggcgcggacatgatcaatgac
atcaatggcttcaatgcgccgggcgcgttgactgcagtcaatgaaagcgattgtggcttg
tgcatcatgcatatgcagcgtgatccgcaaaccatgcaggccgccccggtttatgaggat
gttgtacggaacgtgacggactacctgcgccagcgcgtggatgcaatggccgctgccggc
atttcccgcgcccgcatgtgcatcgatccgggctttggctttggcaaaacgcttgcgcat
aatcttgaattgctgaaaaatcttgaagttctcttgcaggaactgcaattgccgcttttg
gccggcatgtcgcgcaagaccatgattggcatgctgatcggcaagccggtcgagcagcgt
gccgccggcagtgttgccgccgcgctggtggctgcagcgcatggcgcacgcatcgtgcgg
gtgcatgatgtggccgcgacggtcgatgcgctcaaggtctggcaagcgtcgcggcaggat
gctgcatga

DBGET integrated database retrieval system