KEGG   Janthinobacterium sp. LM6: BZG29_00335Help
Entry
BZG29_00335       CDS       T04756                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
jal  Janthinobacterium sp. LM6
Brite
KEGG Orthology (KO) [BR:jal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BZG29_00335
Enzymes [BR:jal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BZG29_00335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored FAD_binding_3 K_oxygenase NAD_binding_8 Thi4 Glutaredoxin AlaDh_PNT_C FMO-like Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: AQR66973
UniProt: A0A1S6F072
LinkDB All DBs
Position
complement(77832..79427)
Genome map
AA seq 531 aa AA seqDB search
MLDATLKTQLKSYLEKVVYPLELVASLDDSAKAREMKELLQEIVLLSDKITLVERLDAGV
RTPSFSINRPGTDIGVRFAGVPLGHEFTSLVLALLQVGGHTIKFDDAVIEQIRNLDGDYE
FETFISLSCHNCPEVVQALNAMAVINPRIKVTTIDGGVFPQEVEARQIMAVPMMFLNGEH
FGQGRTNVEEILAKLDTNAGARQAEALNKKDVFDVLIVGGGPAGAAAAIYAARKGINTGV
LAERFGGQVLDTLAIENFISVKETDGPKFAVALEQHVKEYDVDIMNTQRAAKLTPGKLIE
IETANGAVLKAKTVILATGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVKHVTLIEFGAELRADAVLQRKLHSLPNVTVITSAQTTEIHGNGKIV
NGLSYTDRVSGESKKVELEGVFVQIGLVPNTEWLKGTVALSRHGEIEVDARGQTSIPGVF
AAGDVTTVPYKQIIIATGEGAKAALSAFDHLIRSDDEEVVDESAAKEALTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgctaccctcaaaacccaactgaaatcctacctggaaaaagtggtgtatccg
cttgagctggtcgcttctctcgatgacagcgcaaaagcccgcgagatgaaggaattgctc
caggagatagtcctgttgagcgacaagatcacgctggtcgagcgccttgacgctggcgta
cggaccccgtcgttcagcatcaaccgcccaggcaccgatatcggcgtgcgtttcgccggc
gtgccgctgggccatgaatttacctcgctggtgctggcgctgctgcaagtgggcggccac
accatcaagttcgacgatgccgtgatcgagcagatccgcaacctcgacggcgactacgag
tttgaaacgtttatttcgctctcctgccataactgcccggaagtggtgcaggcattgaat
gccatggccgtgatcaacccgcgcatcaaggtcaccaccatcgatggcggcgtgttcccg
caagaagtggaagcgcgccagatcatggccgtgccgatgatgttcctgaacggtgaacac
ttcggccagggccgcacgaatgtcgaggaaatcctcgccaagctcgacaccaacgccggc
gcccgccaggccgaggcactgaacaagaaagacgtgttcgacgtgctgatcgtcggcggc
ggccctgccggcgcggcagcggccatctacgcggcccgcaagggcatcaacacgggcgtg
ctggccgagcgtttcggcggccaggtgctcgataccttggccatcgagaatttcatttcc
gtcaaggaaaccgatggtccgaagttcgccgtggcgctggaacagcacgtcaaggaatac
gacgtcgacatcatgaacacgcagcgtgccgccaagttgacgccaggcaagctgatcgaa
attgaaacggcgaatggcgccgtgctgaaagccaagaccgtcatcctggccaccggcgcc
cgctggcgcgaaatcaacgtgccgggcgagaaggaataccgcaaccacggtgtcgcctac
tgcccgcactgcgatggtcccttgttcaagggcaagcgcgtggccgtgatcggcggcggc
aactcgggcgtggaagcggcgatcgacttggccggcctcgtgaaacacgtgaccctgatc
gagttcggcgcggaactgcgcgccgatgcggtgctgcagcgcaagctgcacagcttgcct
aacgtgacggtgattacgtcggcgcagaccaccgaaatccacggcaacggcaagatcgtc
aatggcctctcctacacggaccgggtcagcggcgaatcgaagaaggtcgaactggaaggc
gtcttcgtgcaaatcggcctggtgccgaacacggaatggctgaaaggcacggtagcgttg
tcgcgccacggcgaaatcgaagtggacgcacgcggccagacctcgatccccggcgtgttt
gcggccggcgacgtcaccacggtgccgtacaagcagatcatcatcgccaccggcgaaggc
gccaaggcagccctgtccgcctttgaccacctgatccgctccgacgacgaggaagtggtc
gacgagtccgccgccaaggaagcactgacggcgtaa

DBGET integrated database retrieval system