KEGG   Janthinobacterium sp. LM6: BZG29_05645Help
Entry
BZG29_05645       CDS       T04756                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00473  D-Alanine metabolism
jal00550  Peptidoglycan biosynthesis
jal01100  Metabolic pathways
jal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:jal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BZG29_05645
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BZG29_05645
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BZG29_05645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:jal01011]
    BZG29_05645
Enzymes [BR:jal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BZG29_05645
Peptidoglycan biosynthesis and degradation proteins [BR:jal01011]
 Precursor biosynthesis
  Amino acid ligase
   BZG29_05645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 GARS_A RimK ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AQR67905
UniProt: A0A1S6F2N7
LinkDB All DBs
Position
1260490..1261458
Genome map
AA seq 322 aa AA seqDB search
MNQASAIDVKQLGKVGVLFGGRSAEREVSLMSGAGVLAALKSHGVDAHGFDTGERSLAEL
AAEKFDRVFIALHGRFGEDGSLQGALEQLGIPYTGSGVMACSVGMDKVYTKMVWLMHQLP
TPKYAVLDDSSDLAKVAAELGLPLIVKPPHEGSSIGITTVNEASAFQAAYDIAAGLDDSV
LAEEFIKGREFTVAILGKGATARALPPIEIVAPQGNYDYQNKYFTDDTQYFCPPQLDPAI
IAEMERIALAAYRALGCEGWGRVDVLMRAVDSKLFLLEVNTSPGMTGHSLVPMAARAEGT
SYEDLCLEIVAGASLKMHKGRR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccaagcttcagctatcgacgtaaaacaattgggcaaggtcggcgtcctgttcggc
ggccgttcggccgagcgcgaagtgtcgctgatgtccggcgcgggcgtgctggccgctttg
aaaagccatggcgtggatgcgcatggcttcgacacgggcgaacgcagcctggccgaactg
gccgctgaaaagtttgaccgcgtcttcatcgcgctgcacggccgcttcggcgaagacggc
agcctgcagggcgcgctggaacagctgggcatcccgtacacgggcagcggcgtgatggct
tgctcggtgggcatggacaaggtctataccaagatggtctggctgatgcaccagctgccg
acgccaaagtacgcggtgctggacgacagttccgatctggccaaggtcgctgcggaactg
ggcttgccgctgatcgtcaagccgccgcatgaaggctcgagcatcggtatcacgacggtc
aacgaagcgtccgccttccaggccgcctacgacatcgccgccggcctcgatgattcggtg
ctggccgaggaattcatcaagggccgcgagttcaccgtcgcgatcctgggcaagggcgcc
acggcgcgcgcgttgccgccgatcgaaatcgtcgcgccgcaaggcaattacgattaccag
aacaagtacttcacagacgatacgcagtatttctgcccgccgcagctggacccggccatc
atcgccgagatggaacgcatcgccctggcggcgtaccgcgccctcggctgcgaaggctgg
ggacgggtcgatgtgctgatgcgcgcggtcgacagcaagctgtttttgctggaggtgaat
acctcgcccggcatgaccgggcactcgctcgtgccgatggcggcgcgcgcggaaggcacc
agctatgaagacctgtgcctggaaatcgttgccggcgcaagcctgaaaatgcacaaggga
cggcgctga

DBGET integrated database retrieval system