KEGG   Janthinobacterium sp. LM6: BZG29_05900Help
Entry
BZG29_05900       CDS       T04756                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00010  Glycolysis / Gluconeogenesis
jal00620  Pyruvate metabolism
jal01100  Metabolic pathways
jal01110  Biosynthesis of secondary metabolites
jal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZG29_05900
   00620 Pyruvate metabolism
    BZG29_05900
Enzymes [BR:jal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BZG29_05900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AQR67943
UniProt: A0A1S6F337
LinkDB All DBs
Position
1315389..1316909
Genome map
AA seq 506 aa AA seqDB search
MNLADISKLGVANPFKQRYDNYIGGKFVAPVKGEYFPNITPITGLPFCEIARSTTEDVEL
ALDAAHAAKEAWGKTSPAERANILNRIADRIEQNLSLIATAETIDNGKPIRETMNADIPL
AIDHFRYFAGCIRAQEGSVAQIDAETYAYHYHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASIMVLIELIGDLLPPGVLNIINGFGLEAGKPLASSKRIAKIAFTG
ETGTGRLIMGYAAQNLIPVTLELGGKSPNIFFEDVMDADDEYFDKCLEGFAMFALNQGEV
CTCPSRVLIQESIYEKFIERALKRVAAIKQGNPLDSSTMIGAQASQEQLEKILSYLDIGR
QEGAEVLAGGERNTQAGDLEGGYYVRPTVFKGNNKMRIFQEEIFGPVVSVTTFKDEADAL
AIANDTLYGLGAGLWTRDGSRAFRMGRAIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgcagacatcagcaaactgggcgtagccaatcccttcaaacaacgctatgac
aattacatcggcggcaaattcgttgcaccagtaaaaggtgaatactttcccaacattacg
ccgatcaccggcttgccgttttgcgaaatcgcccgttccacgacggaagacgtcgagctg
gcgctggacgccgcccatgccgccaaggaggcctggggcaagacttcgcctgccgagcgc
gccaacatcctgaaccgcatcgccgaccgcatcgaacagaacctgagcctgatcgccacg
gcggaaaccatcgacaacggcaagcccatccgtgaaacgatgaacgccgacattccgctg
gccatcgaccatttccgttacttcgccggctgcatccgcgcgcaggaaggttccgtcgcg
caaatcgatgcggaaacctatgcctaccactaccacgagccgctgggcgtcgtgggccag
atcattccgtggaatttccctatcctgatggccgtgtggaaactggcgccagccctggcg
gccggcaattgcgtcgtgctcaaaccggccgagcagacgccggcgtccatcatggtgttg
atcgagctgatcggcgacctgttgccgcctggcgtgttgaacatcatcaacggtttcggc
ttggaagcgggcaagccgctggcgtcgagcaagcgcatcgccaagatcgcctttacgggc
gaaacgggcacgggccgtttgatcatgggctacgcggcgcaaaacctgattcccgtcacc
ctggagctgggcggcaaatcgccgaacatcttctttgaagacgtgatggatgcggacgac
gagtatttcgacaagtgcctggaaggttttgcgatgtttgcgctgaatcaaggcgaggtg
tgcacctgcccatcgcgcgtgctgatccaggaatcgatctacgagaaattcatcgaacgg
gccctgaagcgcgtggctgccatcaagcagggcaacccgctcgattcgtccaccatgatc
ggcgcgcaggcatcgcaggagcagctggaaaaaatcctgtcctatctcgacatcggccgc
caggaaggcgccgaagtgctggccggcggcgagcgcaacacgcaggcgggcgacctggaa
ggcggctactacgtgcgtccgaccgtgttcaagggcaacaacaagatgcgcatcttccag
gaagagattttcggaccggtcgtctccgtgaccaccttcaaggacgaggccgacgcgttg
gcgattgccaacgataccttgtacggcctgggcgccggcctgtggacgcgcgatggttcg
cgcgccttccgcatgggacgcgccatccaggcgggacgcgtgtggaccaattgctaccac
ctgtatcccgcccacgccgcgttcggcggctacaagcaatcgggtatcggccgcgaaaac
cacaagatgatgctcgatcactaccagcaaacgaagaacttgctggtgagctatagcccg
aaagcgctgggcttcttctaa

DBGET integrated database retrieval system