KEGG   Janthinobacterium sp. LM6: BZG29_06180Help
Entry
BZG29_06180       CDS       T04756                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00970  Aminoacyl-tRNA biosynthesis
jal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jal00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BZG29_06180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:jal03029]
    BZG29_06180
Enzymes [BR:jal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BZG29_06180
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BZG29_06180
Mitochondrial biogenesis [BR:jal03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BZG29_06180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AQR67991
UniProt: A0A1S6F2X7
LinkDB All DBs
Position
1387624..1388985
Genome map
AA seq 453 aa AA seqDB search
MDLTGKRTIRELAADLAAGRISSVALTEQMLARAEAHRAQGGHAYVSLDGAQALAEARAS
DAARASGWVPSPLAGVPISIKDLFDVRGQVSSAASLVLADAPPAVVDAGAVARLRAAGAI
LLGRTNMSEFAFSGLGLNPHYGTPRNPHDRARVAGGSTSGGAVTVALYMAAGALGTDTGG
SIRIPSAFCGLTGFKPTAASVSLAGTVPLSRSLDSAGPIAHSVDCCAILYAALSGHDIGA
QAPALKGLRFGFTLDYVGTHVAPQVQQAFDAALDKLRQAGALVEQFDFPELLELPTINGG
GGLVAAEAWHWHRALLEEKGAQYDQRVAARIRRGQQQGAADYIDLLDARARLIGVARRRL
APFDAWLMPSVAILAPEVAPLEADDATFFATNGLVLRNASVINFLDGCALSLPCHADGEL
PVGLGICGLAGEDGQMLQIGCAVEALLRGRGKE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggatttgactggcaagaggacgataagggaactggcggccgacctggccgccggccgc
atcagcagcgtggcactgacagagcagatgctggcgcgcgccgaggcgcaccgggcgcag
ggcggccatgcgtatgtgagcctcgatggcgcgcaagccctggccgaggccagagccagc
gacgcggcgcgcgcctccggctgggtgccttcaccgctggccggcgtgcctatctcgatc
aaggacctgttcgacgtcagggggcaggtcagcagcgccgcctcgctggtgctggctgac
gccccgcccgccgttgtggatgccggcgccgtggcgcgcctgcgcgcggcaggcgccatc
ctgctgggccgcaccaacatgagcgaattcgcattttccggcctgggcttgaatccccat
tacggcacgccgcgcaatccgcacgaccgcgcgcgcgtggcgggcggctccacctcgggc
ggcgccgtgacggtggcgctgtacatggcggccggcgcgctgggcacggatacgggcggc
tcgatccgcattccgtccgctttttgcggcctgacgggcttcaagccgacggccgcttcc
gtgtcgctggccggcactgtgcccttgtcgcgctccctcgattcggccggccccatcgcg
cacagcgtcgattgctgcgccattttgtacgcggcgctgtcgggccatgacatcggcgcg
caggcgccggcactgaaaggcttgcgcttcggctttaccctggactacgtcggcacgcac
gtggcgccgcaggtgcagcaggctttcgatgctgccctggacaagctgcggcaagccggc
gccctggtggaacagttcgatttccccgagttgctggagctgccgacgatcaatggcggc
ggcgggctggtggcggcggaagcctggcactggcacagggcgttacttgaagagaagggc
gcgcagtacgaccagcgcgtggcagcgcgcatccgccgcggccagcagcagggcgcagcc
gactacatcgacctactcgatgcgcgcgcgcgcctgatcggcgtcgcccggcggcgcctg
gcgccgttcgatgcctggctgatgcccagcgtggccatactggcgccggaagtcgcgccg
ctggaagcggatgacgccactttttttgccacgaatggcctggtgctgcgcaacgccagc
gtgatcaacttcctcgacggctgcgcgctgtcgctgccttgccacgccgacggcgagctg
cccgtcgggctgggcatttgcggcttggcgggggaggacggtcaaatgctgcaaatcggc
tgcgccgtggaggcgctgctgcgggggcgtggaaaagaataa

DBGET integrated database retrieval system