KEGG   Janthinobacterium sp. LM6: BZG29_16665Help
Entry
BZG29_16665       CDS       T04756                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00620  Pyruvate metabolism
jal00680  Methane metabolism
jal01100  Metabolic pathways
jal01120  Microbial metabolism in diverse environments
jal01200  Carbon metabolism
Module
jal_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:jal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZG29_16665
  09102 Energy metabolism
   00680 Methane metabolism
    BZG29_16665
Enzymes [BR:jal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BZG29_16665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AQR72035
UniProt: A0A1S6FEH9
LinkDB All DBs
Position
complement(3794486..3797233)
Genome map
AA seq 915 aa AA seqDB search
MNEVKDELLSSDIRQLGRLLGDAIRNHLGDPAFERIEHVRQLAIRFRRDNDEAARAQLSD
ALQALSQEETTQLTRAFSYFSLLANIAEDQHHIRRTRAHLIAGSPPRQGSLSHAVGNVFD
AGKADALETFFDDAFVSPVFTAHPTEVQRKSIQNCQMAIARLLSERDRVQMTPEEAEQNE
EALGRGIVTLWQTRLLRTSKLSVMDEVANGLSFYDHTILRELPKLYSSLETMLAQRDARW
EDAELPNFMKVGSWIGGDRDGNPFVTADILRSTLQTQADKVLDFYLGELRKLASQLSLAQ
ILNACSEPLRALAERSADASPHRVDEPYRRALHGIHARLESTRVVLSGKGKQADGVQPYA
TAAELLTDLDVVQHSLVSNGLRALARGRLRQLRRAVKVFGFSLAPLDLRQNSDVHERVVG
ELFAGAQPGLVYLDLDEEQRIAVLLAELESPRLLASPYAQYSEETTSELDIFRAVRAAHV
KYGKESVPNCIISKAASVSDLLEVALLLKEVGLLRQDSREVDVNIIPLFETIDDLRAGPA
IMARAFGLPFYRGLLKSRADQQEVMLGYSDSNKDGGFLTSGWELYKAEIELVTVFKQYQI
KLRLFHGRGGSVGRGGGPSYEAILAQPAGAVQGQIRLTEQGEVITAKYANPEVGRRNLEV
LVAATIQSTLLPQAQLQPKASAGAGHLAAMEELSGTALNAYRDLVYGTEGFEQYFWESTV
IAEIAALNIGSRPASRKKSTSIEDLRAIPWVLSWAQCRLMLPGWFGFGSAVQAYLAAHPA
DGADVLRGMYTDWPFFTSLLSNMDMVLAKSDIAIAGKYAELVKDKTLREAIFTRIRAEYA
ATLDALKLITGQEELQQANPLMQRSIRNRFPYIDPLNHVQVELLKRFREGKQDAAARTGI
HLSINGIAAGLRNSG
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtgaaagacgagctgctgagcagcgatatccgccagctgggccgtctgctg
ggcgacgccatccgcaaccacctgggcgaccccgccttcgagcgcatcgaacatgtgcgc
cagctggccatccgtttccgccgcgacaatgatgaagcggcgcgcgcgcagctgtccgat
gcgctgcaagcgctgtcgcaggaagaaaccacgcaattgacgcgcgctttcagctatttc
tcgctgctggccaatattgcggaagatcaacatcacatccgccgcacgcgcgcccatctg
atcgccggttcgccgccgcgccagggtagcctcagccatgccgtcggcaatgtgtttgac
gcaggcaaggccgatgcgctggaaacgttcttcgacgatgcgtttgtcagccccgtcttc
acggcgcatccgacggaagtgcagcgcaagagcatccagaattgccagatggctatcgcc
cgcctgttgagcgagcgcgaccgcgtgcaaatgacgccggaagaggcggaacagaacgaa
gaagcgctgggccgcggcatcgtcaccttgtggcagacgcgtttgttgcgcacgagcaag
ttgtccgtcatggatgaagtggccaatggcctgtcgttctacgaccacacgattttgcgc
gaattgccgaaattgtattcctcgctggaaaccatgctggcccagcgcgatgcccgctgg
gaagatgcggaattgcccaatttcatgaaggtcggcagctggatcggcggcgaccgcgac
ggcaaccccttcgtcacggccgacatcctgcgcagcaccctgcagacgcaagcggacaag
gtgctcgacttttacctcggtgaattgcgcaagctcgcttcgcaactgtcgctggcgcaa
atcctcaatgcctgcagcgagccgctgcgcgcgctggccgagcgttcggccgacgcgtcg
ccgcaccgcgtcgacgagccgtaccgccgcgccctgcatggcattcatgcgcgcctggaa
agcacgcgcgtcgtgctatccggcaagggcaagcaggcagacggcgtgcagccctacgcg
actgccgccgaactgctgaccgacctggacgtggtccagcattcgctcgtcagcaacggc
ttgcgcgcgctggcgcgtggccggctgcgccagctgcgccgcgccgtcaaggtgttcggt
ttttcgctggcaccgctcgatctgcgccagaattccgacgtgcacgagcgcgtcgtgggc
gaactgttcgccggcgcccagcctggcctggtctacctggatctcgatgaagagcagcgc
atcgccgtgctgctggccgagctggagtcgccgcgcctgctggcgtcgccgtatgcgcag
tactcggaagaaacaacgtccgaactcgacatcttccgcgccgtgcgcgcagcccatgtc
aaatatggtaaggaatcggtgccgaactgcatcatctccaaggcggccagcgtctcggac
ttgctggaagtggccttgctgctgaaggaagtgggcttgctgcgccaggacagccgcgaa
gtggacgtcaacatcatccccctgtttgaaaccatcgacgacttgcgcgccggccccgcc
atcatggcgcgcgccttcggcttgccgttctaccgtggcttgctcaaatcgcgcgcggac
cagcaggaagtcatgctcggctattccgacagcaacaaggacggcggcttcttgacctcc
ggctgggaactttacaaggccgagatcgagctggtgacggtcttcaagcaataccagatc
aagctgcgcttgttccacggccgcggcggctccgtgggacgcggcggcggccccagctac
gaagccatcctggcccagccggccggcgccgtgcagggacagatccgcctgacggagcag
ggcgaagtcatcacggccaaatatgcgaacccggaagtcgggcgccgcaacctggaagtg
ctggtggccgccaccatccagtcgaccctgctgccgcaggcgcagctgcagccgaaggct
tcggccggcgcgggccatctggccgccatggaagagctgtccggcacggccctgaacgcc
taccgcgacctcgtgtacggcacggaaggcttcgaacaatacttctgggaatcgacggtg
atcgccgaaattgccgcactgaacatcggcagccgtcccgcctcgcgcaagaaatcgacc
tcgatcgaggatttgcgcgccattccctgggtcttgagctgggcgcaatgccgtttgatg
ctgccaggctggttcggtttcggttccgctgtgcaagcctacctggctgcccatcccgcc
gacggcgcggacgtgctgcgcggcatgtacacggactggccattcttcacgtcattgctg
tcgaacatggatatggtgctggccaagagcgacatcgccatcgccggcaagtatgcggaa
ctcgtcaaggataaaaccttgcgcgaggccatctttacgcgcatccgcgccgaatacgcg
gccaccctggacgccttgaagctgatcacgggccaggaagagttgcagcaagccaatccg
ctgatgcagcgctcgatacgcaaccgtttcccgtatatcgacccgctcaaccacgtgcag
gtggagctgttgaaacgtttccgcgagggtaaacaggatgcggcggcgcgcacgggcatt
catttgtcgatcaatgggattgcggctggcctgcgcaatagcggttaa

DBGET integrated database retrieval system