KEGG   Janthinobacterium sp. LM6: BZG29_16930Help
Entry
BZG29_16930       CDS       T04756                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00020  Citrate cycle (TCA cycle)
jal00480  Glutathione metabolism
jal01100  Metabolic pathways
jal01110  Biosynthesis of secondary metabolites
jal01120  Microbial metabolism in diverse environments
jal01130  Biosynthesis of antibiotics
jal01200  Carbon metabolism
jal01210  2-Oxocarboxylic acid metabolism
jal01230  Biosynthesis of amino acids
Module
jal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jal_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:jal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BZG29_16930
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BZG29_16930
Enzymes [BR:jal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BZG29_16930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH MRP-L27 DUF4171
Motif
Other DBs
NCBI-ProteinID: AQR72041
UniProt: A0A1S6FEJ2
LinkDB All DBs
Position
complement(3853048..3855279)
Genome map
AA seq 743 aa AA seqDB search
MATQKSKIIYTLTDEAPLLATYSLLPIIKKFTAPAGVDVVASDISVAARVLAEFPEFLTD
AQKVPNTLAELGKLTQNPDTNIIKLPNISASQGQLIACVRELQGRGYKLPDYPEDAKTDE
EKALKARYGKCIGSSVNPVLREGNSDRRAPKAVKEYARKHPHSMGEWSQSSQTHVSHMHH
GDFYHGEKSLTLEKARDVKMELVTASGKTIVLKPKVSLQAGEIIDSMFMSKKALLEFYEK
EIDDAFKTGVMFSLHVKATMMKVSHPIVFGHCVRIFYKDAFAKHAALFDKLGVNVNNGMS
NLYDKIETLPASQKDEVLKDLHACHANRPELAMVDSAKGITNFHSPNDIIVDASMPAMIR
IGGKMWGADGRPKDVKAVMPESTFARIYQEMIGFCKWHGNFDPKTMGTVPNVGLMAQQAE
EYGSHDKTFEVPEGGIANITDLETGEVLLTQTVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDSYRPHENEVIKKVQVYLKEHDTKGLDIQIMSQTRAMRYTLERAFRGLD
TISVTGNILRDYLTDLFPILELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDMGIKTGNAKAKILAKTLDEATGKLLDNNKSPSPRTGELDNR
GSHFYLAMYWAQALAVQKDDAELAAHFAPVAKALADNEEKIVAELKAVQGKETDIGGYYL
PDPAKTEAVMRPSASLNAVLDSI
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaaaaatccaaaatcatctacacgctgactgacgaggcgccgctgctcgcg
acgtattccctgctgccaattatcaaaaaattcaccgcgccggctggcgtggacgtggtc
gccagcgatatttcggtagcggcccgtgtactggctgaatttcccgaattcctgacggac
gcgcaaaaagtcccgaacaccctggctgaactgggcaaattgacccagaatccggacacc
aacatcatcaaattgccgaacatcagcgcttcgcaaggccagttgatcgcctgcgtgcgc
gaattgcaaggccgtggctacaagctgccggactacccggaagatgcgaagacggacgaa
gaaaaagccttgaaagcccgctacggcaagtgcatcggcagctcggtcaacccggtcttg
cgcgaaggcaattccgaccgccgcgcgccgaaggccgtcaaagagtacgcgcgcaagcac
ccgcattcgatgggcgagtggagccagtcgtcgcaaacgcacgtgtcgcacatgcaccat
ggcgacttctaccatggcgagaaatcgctgaccctggaaaaggcgcgcgacgtcaagatg
gaactggtcacggcctcgggcaagaccatcgtgctgaaaccgaaggtttccctgcaagcg
ggcgaaatcatcgacagcatgttcatgagcaagaaagcgctgctggagttctacgagaag
gaaatcgacgatgccttcaagacgggcgtgatgttctcgctgcacgtcaaggcgaccatg
atgaaggtttcgcaccctatcgtcttcggccactgcgtgcgcatcttctacaaggacgcg
ttcgccaagcacgccgcgctgttcgacaagctgggcgtgaatgtcaacaatggcatgagc
aacctgtacgacaagatcgaaaccttgccagcgtcgcaaaaagatgaagtgctgaaagat
ttgcacgcctgccacgccaaccgtccggaactggccatggtcgattcggccaagggcatc
accaacttccattcgccgaacgacatcatcgtcgacgcgtcgatgccagccatgatccgt
atcggcggcaagatgtggggcgccgatggccgtccgaaggacgtcaaggccgtcatgccg
gaatcgactttcgcgcgcatctaccaggaaatgatcggtttctgcaaatggcatggcaac
ttcgatccgaagaccatgggcaccgtaccgaacgtgggcctgatggcgcagcaagcggaa
gaatacggttcgcacgacaagacgtttgaagtgccggaaggcggcatcgccaacatcacc
gacctggaaacgggcgaagtgctgctgacgcaaacggtggaagagggcgatatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtcaagctggccgtcacgcgcgcg
cgcaattcgggcatgcctgccgtgttctggctcgattcctaccgtccgcacgagaacgaa
gtcatcaagaaggtacaggtgtacctgaaggagcacgacaccaagggcctggacatccag
atcatgtcgcaaacgcgcgccatgcgttacaccctggaacgcgccttccgcggcctggac
accatctcggtgaccggcaacatcctgcgcgattacctgaccgacctgttcccgatcctg
gaactgggcacgtccgccaagatgttgtcgatcgtgccattgatggccggtggcggcatg
tatgaaacgggcgctggcggttcggcaccgaaacacgtcaagcaactggtggaagaaaac
catttgcgctgggattcgctgggcgagttcctggccctggccgtgtcgctggaagacatg
ggcatcaagacgggcaatgcgaaggccaaaatcctcgcgaaaaccctcgacgaagccacc
ggcaagctgctggacaacaacaagtcgccatcgccacgtaccggcgagctggacaaccgt
ggcagccatttctacctggccatgtattgggcgcaagccctggctgtgcagaaggacgat
gcggaactggcagcgcattttgcgccggtggccaaggccctggccgacaacgaagaaaag
atcgttgccgagctgaaagcagtgcaaggcaaggaaacggatatcggcggctactacctg
ccagatccggcgaagacggaagccgtcatgcgtcctagcgccagcctgaatgcagtgctc
gacagcatctga

DBGET integrated database retrieval system