KEGG   Janthinobacterium sp. LM6: BZG29_23440
Entry
BZG29_23440       CDS       T04756                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal01040  Biosynthesis of unsaturated fatty acids
jal01100  Metabolic pathways
jal01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:jal00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BZG29_23440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:jal01004]
    BZG29_23440
Enzymes [BR:jal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BZG29_23440
Lipid biosynthesis proteins [BR:jal01004]
 Desaturase
  First
   BZG29_23440
SSDB
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 Perilipin
Other DBs
NCBI-ProteinID: AQR70938
UniProt: A0A1S6FBR6
LinkDB
Position
complement(5332521..5333729)
AA seq 402 aa
MTLSSVLHDVLQFMATGITDLSAWQVFLYTMVVTHITIASVTIYLHRHQAHRALELHAIP
SHFFRFWLWLTTGQVTKEWAAIHRKHHAKCDTEEDPHSPVTRGIKKVFWEGAELYRAESK
NMETMAKYGHGTPTDWIERNLYTKYSWLGVVSLFVINFILFGVIGISVWAVQMMWIPITA
AGIINGIGHYWGYRNYDCADAATNIIPFGILIGGEELHNNHHTYATSAKLSSKWYEIDIG
WAYIRALEMLGLAKVKKLAPAPKFSHGKLEADFETLQSVIANRYDVMAKYAKSIKHAWKE
ELEHLKHKAELEKRFLKSSRKLMQREPGKLADAHHEQLSELFQHSKALETMHHMRVELGA
IWERSHFTREQLLQKLQDWCTRAEASGIKSLQDFSLRLRSYA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgacattgagttccgttttacacgacgttttgcagttcatggcaactggcattaccgat
ctgtccgcatggcaagttttcctgtacaccatggtggtcacgcatatcaccatcgccagc
gtcacgatttacctgcaccgccaccaggcccaccgggcgctggaattgcatgcgatcccc
agccatttcttccgtttctggctgtggctgacgacgggccaggtgaccaaggaatgggcg
gccatccaccgcaagcaccacgccaagtgcgatacggaagaagatccgcacagccccgtg
acgcgcggcatcaagaaagtcttctgggaaggcgccgagctgtaccgcgctgaatcgaag
aacatggaaaccatggcgaaatatggccacggcacgccgacggactggatcgagcgcaac
ctgtacaccaagtacagctggctgggcgtggtgtcgctgttcgtcatcaatttcattttg
ttcggcgtgatcggcatttccgtgtgggccgtgcaaatgatgtggatcccgatcacggcg
gccggcatcatcaacggcatcggccactactggggctaccgcaattacgactgcgccgat
gcggccaccaacatcattcccttcggcatcctgatcggcggcgaagagttgcacaacaat
caccatacgtatgcgacctcggccaagctgtcgtcgaaatggtatgaaatcgatatcggc
tgggcgtatatccgcgcgctggaaatgctgggcctggccaaggtcaaaaaactggcgccg
gcgccgaagttctctcacggcaagctggaagcggacttcgagaccttgcagtccgtcatc
gctaaccgctacgacgtgatggccaagtacgcgaaatcgatcaagcatgcctggaaggaa
gagctggagcacctgaagcacaaggcggaactggaaaagcgcttcctgaaatcgtcgcgc
aagctgatgcagcgcgagccgggcaagctggccgatgcgcaccatgagcaactgtcggaa
ttgttccagcacagcaaggcgctggaaaccatgcaccatatgcgcgtggagctgggcgcc
atctgggaacgttcgcactttacgcgtgaacaattgctgcaaaagctgcaagactggtgc
acgcgcgccgaagcgtcgggcatcaagtcgctgcaggatttttccttgcgcctgcgcagc
tatgcctga

DBGET integrated database retrieval system